Recombinant Heterosigma carterae Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The Recombinant Heterosigma carterae psbA protein is a full-length (1-344 amino acids), His-tagged protein expressed in E. coli . Key specifications include:

ParameterDetails
UniProt IDQ32389
SpeciesHeterosigma carterae (Chromophytic alga/Olisthodiscus carterae)
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles

The protein is used primarily in research applications, including enzyme-linked immunosorbent assays (ELISA) and studies of PSII function .

Research Applications

  • Biochemical Assays: Used in ELISA for quantifying D1 protein levels or studying herbicide interactions .

  • Structural Studies: The recombinant protein aids in crystallography and mutagenesis to map PSII functional domains .

  • Environmental Stress Response: Investigated for its role in photodamage repair and redox potential modulation under high-light stress .

Comparative Analysis with Other psbA Proteins

FeatureH. carterae psbA P. micans psbA H. triquetra psbA
Length (aa)344343348
Host SpeciesChromophytic algaRed tide dinoflagellateDinoflagellate
Key ResiduesTyr112, Ala251Tyr112, Ala251Tyr112, Ala251
ApplicationsELISA, herbicide studiesStructural biologyFunctional mutagenesis

Biochemical Data and Quality Control

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for long-term stability .

  • Stability: Degrades rapidly if subjected to repeated freeze-thaw cycles; working aliquots stored at 4°C retain activity for ≤1 week .

  • Functional Validation: Activity confirmed via oxygen evolution assays and thermoluminescence studies in related species .

Key Research Findings

  • Herbicide Binding: The QB-binding site (Ala251) influences herbicide affinity, as shown in Chlamydomonas reinhardtii mutants .

  • Photoinactivation: Mutations (e.g., Y112L) impair D1 turnover and PSII recovery, highlighting the protein’s role in photoprotection .

  • Evolutionary Conservation: Cyanophage psbA homologs share functional motifs with algal variants, suggesting horizontal gene transfer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Heterosigma akashiwo (Chromophytic alga) (Heterosigma carterae)
Target Names
psbA
Target Protein Sequence
MTATLERRESFSLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSCYIIAFIAAPPVDI DGIREPVAGSLMYGNNIITGAVIPSSNAIGVHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETSEIESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVVGIWLTALGVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII consists of a core antenna complex responsible for photon capture, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what protein does it encode?

The psbA gene encodes the D1 protein, a core component of photosystem II (PSII) that plays a crucial role in oxygenic photosynthesis. D1 is particularly significant because it binds most of the active components of the electron transfer chain in PSII . In cyanobacteria, the D1 protein undergoes rapid light-induced turnover, indicating its vulnerability in the photosynthetic process . The D1 protein forms part of the reaction center where initial charge separation occurs during photosynthesis, making it essential for converting light energy into chemical energy.

What is the functional role of the D1 protein in photosystem II?

The D1 protein serves as a central component in the electron transfer chain of photosystem II. Following light absorption, initial charge separation occurs via chlorophyll D1 (Chl D1) and pheophytin D1 (Pheo D1), which are associated with the D1 protein . The generated electron is transferred to two quinone electron acceptors, QA and QB . The QB site, partly formed by the D1 protein, accepts two electrons and two protons to form a plastoquinol molecule that is released from its binding site and replaced by an oxidized quinone from the plastoquinone pool . This process is integrated with the oxygen-evolving complex (OEC) and participates in the Kok cycle, where water molecules are split to produce molecular oxygen.

How are psbA sequences used in phylogenetic studies?

The psbA gene sequences serve as valuable markers for phylogenetic analysis across different taxonomic groups. In prior research, eukaryotic psbA gene sequences from Heterosigma akashiwo and H. carterae were used as outgroups for phylogenetic analysis of cyanobacterial and cyanophage sequences . Phylogenetic analyses have demonstrated that psbA sequences from freshwaters have evolutionary histories distinct from their marine counterparts . Additionally, sequences from cyanophages infecting Prochlorococcus and Synechococcus can be readily discriminated, as can sequences from different viral families like podoviruses and myoviruses . This differentiation makes psbA an excellent marker for exploring the diversity and evolutionary relationships of photosynthetic organisms and their viruses.

What techniques are commonly employed for isolating and characterizing the psbA gene?

Based on methodologies described in the research literature, several techniques are commonly used for isolating and characterizing the psbA gene:

  • PCR amplification with psbA-specific primers for gene detection and quantification

  • Phylogenetic analysis to understand evolutionary relationships among different variants

  • GC content analysis to infer genomic origins and evolutionary pressure

  • Sequence motif analysis, particularly examining variable triplet peptides in the D1 protein motif R/KETTXXXSQ/H

  • X-ray crystallography to determine the structure of the D1 protein and its interactions with other components of photosystem II

The combination of these techniques provides comprehensive insights into the sequence, structure, and function of the psbA gene and its encoded D1 protein.

How do environmental factors influence psbA gene expression?

Environmental factors significantly impact psbA gene expression, particularly in organisms with multiple psbA genes. In the thermophilic cyanobacterium Thermosynechococcus elongatus, three psbA genes (psbA1, psbA2, and psbA3) encode the D1 subunit of PSII and are expressed differently in response to environmental changes . Similar patterns have been observed in Synechococcus PCC 7942, which has three psbA genes encoding two different D1 protein isoforms . This differential expression likely represents an adaptive mechanism that allows organisms to optimize photosynthetic performance under varying environmental conditions, such as changes in light intensity, temperature, or nutrient availability.

What structural differences exist between D1 protein variants and how do they impact function?

Structural analysis of different D1 protein variants reveals several key differences that influence function:

  • In cyanobacteria, the change from Gln to Glu at position D1-130 in PsbA2 and PsbA3 strengthens the hydrogen bond with pheophytin D1, partially explaining the increased redox potential observed in PsbA3 .

  • The D1-Y147F substitution in PsbA2 results in the loss of a hydrogen bond in Pheo D1, potentially explaining the decreased stability of Pheo D1 in PsbA2 .

  • The D1-P173M change in PsbA2 leads to the loss of two water molecules in the Cl-1 channel, causing channel narrowing and potentially explaining the lower efficiency of S-state transitions beyond S2 in PsbA2-PSII .

  • In PsbA3-PSII, the change from D1-Ser270 to D1-Ala270 eliminates a hydrogen bond with a sulfoquinovosyl-diacylglycerol molecule near QB, which may facilitate easier exchange of bound QB with free plastoquinone and enhance oxygen evolution through improved QB exchange efficiency .

These structure-function relationships demonstrate how specific amino acid changes in the D1 protein can fine-tune electron transfer properties and photosynthetic efficiency.

What methodological approaches are effective for studying electron transfer dynamics in recombinant D1 proteins?

Several methodological approaches are effective for studying electron transfer dynamics in recombinant D1 proteins:

  • X-ray Crystallography: Provides high-resolution structural information about the protein environment around cofactors, helping to explain observed differences in electron transfer properties .

  • Site-Directed Mutagenesis: Creating specific amino acid changes in the D1 protein allows researchers to examine how these modifications affect electron transfer dynamics, as demonstrated by studies comparing different PsbA variants .

  • Spectroscopic Techniques: Methods such as EPR (electron paramagnetic resonance) spectroscopy can probe the electronic properties of cofactors involved in electron transfer.

  • Oxygen Evolution Measurements: Quantifies the efficiency of water splitting and can be correlated with structural changes in the D1 protein, as seen in the enhanced oxygen evolution in PsbA3-PSII due to high QB exchange efficiency .

  • Redox Potential Measurements: Determines the energetics of electron transfer reactions and can reveal how protein environment influences the redox properties of cofactors.

How does the evolutionary history of Heterosigma carterae psbA compare to that of cyanobacteria and cyanophages?

The evolutionary history of psbA genes reveals distinct patterns across different organisms:

  • Phylogenetic analyses show discrete evolutionary groups of psbA sequences from cyanobacteria, cyanophages, and sequences from marine and freshwater environments .

  • Eukaryotic psbA sequences, including those from Heterosigma carterae, are evolutionarily distinct from cyanobacterial sequences, serving as outgroups in phylogenetic analyses .

  • psbA sequences from Synechococcus, low-light and high-light Prochlorococcus, and their infecting phage families fall into distinct clades, implying separate evolutionary histories with limited genetic exchange among clades .

  • Freshwater and marine phage psbA sequences can be discriminated phylogenetically, suggesting environmental adaptation .

  • The presence of psbA in cyanophages likely results from horizontal gene transfer from their hosts, as these viruses would not typically require photosynthesis genes .

This evolutionary divergence suggests that Heterosigma carterae psbA has followed a unique evolutionary trajectory compared to cyanobacterial and cyanophage sequences, reflecting its adaptation to specific ecological niches and evolutionary pressures.

What experimental design considerations are important when expressing recombinant H. carterae D1 protein?

When expressing recombinant H. carterae D1 protein, several experimental design considerations are crucial:

  • Expression System Selection: The D1 protein contains multiple transmembrane helices, necessitating an expression system capable of properly handling membrane proteins.

  • Cofactor Integration: The functional D1 protein requires proper association with numerous cofactors including chlorophylls, pheophytins, and quinones, which must be considered in the expression and purification protocols.

  • Protein Stability: The D1 protein undergoes rapid turnover in vivo, suggesting potential instability that may require specialized buffer conditions and handling procedures during purification.

  • Membrane Reconstitution: For functional studies, the recombinant D1 protein should be reconstituted into a suitable membrane environment that mimics its native thylakoid membrane context.

  • Functional Validation: Activity assays must be designed to verify that the recombinant protein maintains its electron transfer capabilities, potentially including spectroscopic measurements of charge separation and oxygen evolution assays.

These considerations help ensure that the recombinant H. carterae D1 protein retains its structural integrity and functional properties for subsequent experimental analyses.

How can researchers resolve data contradictions in studies of psbA gene diversity across different environments?

Resolving data contradictions in psbA gene diversity studies requires several methodological approaches:

This multifaceted approach can help resolve contradictions and provide a more comprehensive understanding of psbA gene diversity and evolution across different environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.