Recombinant Hevea brasiliensis 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMGR2)
Shipped with Ice Packs 
In Stock 
Description
Introduction to 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGR)
3-Hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR) is a crucial enzyme in the mevalonate pathway, which is responsible for the biosynthesis of isoprenoids, including sterols and terpenoids. In plants, HMGR plays a pivotal role in regulating the production of phytosterols and other secondary metabolites essential for plant growth and defense. The rubber tree, Hevea brasiliensis, contains multiple HMGR genes, including HMGR2, which is part of a small gene family involved in isoprenoid biosynthesis.
Expression and Regulation of HMGR Genes in Hevea brasiliensis
In Hevea brasiliensis, the HMGR gene family includes five members (HMGR1 to HMGR5). The expression of these genes varies across different tissues and conditions. For instance, HMGR4 and HMGR5 are highly expressed in mature leaves and xylem . While HMGR1 has been associated with high latex yield and is upregulated in high-yielding clones , specific studies on HMGR2's expression patterns and regulatory mechanisms are scarce.
Table 1: HMGR Expression in Hevea brasiliensis
Table 2: Effects of HMGR Overexpression in Plants
| Plant Species | HMGR Overexpression Effect |
|---|---|
| Tobacco | Increased phytosterol content |
| Catharanthus roseus | Enhanced terpenoid production |
| Avocado | Larger fruit size |
References Characterization and Function of 3-Hydroxy-3-Methylglutaryl-CoA Reductase. Characterization and Function of 3-Hydroxy-3-Methylglutaryl-CoA Reductase. Frameshift variation in the HMG-CoA reductase gene and pharmacogenetic relationship with hypercholesterolemia in type 2 diabetes mellitus patients. Expression of the Hevea brasiliensis 3-Hydroxy-3-Methylglutaryl Coenzyme A Reductase in Tobacco. Expression analysis of rubber biosynthetic pathway genes in Hevea brasiliensis. Genome-Wide Identification and Characterization of the HMGR Gene Family. Regulation of partitioned sterol biosynthesis in Saccharomyces cerevisiae.
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HMGR2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)
Target Names
HMGR2
Target Protein Sequence
LESDFADMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKEEVVKKVLKTDVALLVE
LNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATGQDPAQNVESSHCITMMEAVNDGKDL
HISVTLPSIEVGTVGGGTQLASQSACLNLLGVMGACKESPGSYSRLLATIVAGSVLAGEL
SLMSAIAAGQLVKSHMKYNRSSKDVSKAAS
Uniprot No.
Target Background
Function
Catalyzes the synthesis of mevalonate, a precursor for all isoprenoid compounds in plants.
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. Plastid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
