Recombinant High-energy light unresponsive protein 1 (lite-1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant LITE-1 exhibits exceptional photon-capturing efficiency and conformational dependence:

  • Photon Absorption: Directly absorbs UVA (315–400 nm) and UVB (280–315 nm) light without requiring prosthetic chromophores .

  • Conformational Sensitivity: Denaturation with urea abolishes absorption, unlike opsins that retain chromophore-mediated absorption .

  • Key Residues: Two tryptophan residues (positions undisclosed in sources) are critical for photoabsorption .

Comparative Photoreceptor Efficiency

PhotoreceptorExtinction Coefficient (M⁻¹cm⁻¹)Chromophore Dependency
LITE-1>10⁶No (protein conformation)
Bacterial Rhodopsin62,000–63,000Yes (retinal)
Bovine Rhodopsin~40,000Yes (retinal)

Functional Expression

  • Muscle Cell Assays: Recombinant LITE-1 expressed in C. elegans muscle cells induces UV-triggered calcium transients and contractions, confirming its optogenetic utility .

  • Spectrophotometry: Purified LITE-1 absorbs UV light 10–100× more efficiently than opsins (Figure 2G–I) .

Unique Topology

  • Membrane Orientation: Unlike GPCRs or opsins, LITE-1 adopts a reversed topology (C-terminus extracellular), confirmed via antibody staining and bimolecular fluorescence complementation (BiFC) .

Applications and Availability

Recombinant LITE-1 is commercially available for research purposes:

Research Implications

  • Optogenetics: LITE-1’s high UV sensitivity and lack of chromophore dependency make it a promising tool for controlling cellular activity with light .

  • Evolutionary Insight: Represents a novel photoreceptor class, expanding understanding of sensory system diversity in animals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method or location. Kindly consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lite-1; gur-2; C14F11.3; High-energy light unresponsive protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
lite-1
Target Protein Sequence
MPPPSSHSNIFHSTFKHTVKETMANAKKTMIAKILSSRNKWAICDRTLYPIYYLLLILGL NQSIRPNNSLLFRIYSWLVFCLLLFTTLRKFNQVGVRPNGTRENLQEFFANPRSMITLCN ALIMLSGLLASLQLYTLGAKRLKPLKILCQFSLNVRTKQAERRQFMINTFLAVFSGLLAL TMAATYAMSKWGYILYIVGTPNLDTETIFCVLLDSYALFVSRAAISALAILFYQHCSVIR RSIKHLINEMVPAEQDECPLPESSLQKIHDCQISYQRIFNGKAVIEEYYSFVLFYSYGVC IPIFCFLMFVGMSAQSICWSEVVSIVIWIVNAILVLLLFSLPAFMINEDGDRLVASSFRM YHETFHEERDLTVLSQMTFFTFQIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLILWE FDIKNNQSLQNIANHTIHT
Uniprot No.

Target Background

Function
LITE-1 functions as a photoreceptor for short-wavelength (UV) light, mediating UV-light-induced avoidance behavior. It directly senses and absorbs both UV-A and UV-B light with high efficiency. While absorbing UV-B light, it exhibits resistance to photobleaching. Unlike other photoreceptors, LITE-1 does not utilize a prosthetic chromophore to capture photons; its function relies solely on its protein conformation. Although it efficiently absorbs both UV-A and UV-B light, it primarily mediates avoidance behavior in response to UV-B light exposure. It may also play a role in response to white light exposure.
Gene References Into Functions
  1. LITE-1, unlike typical photoreceptors that utilize a prosthetic chromophore for photon capture, strictly depends on its protein conformation for photon absorption. Two tryptophan residues crucial for LITE-1 function have been identified. Notably, LITE-1 exhibits a reversed membrane topology compared to GPCRs. LITE-1, a taste receptor homolog, represents a distinct type of photoreceptor in the animal kingdom. PMID: 27863243
  2. LITE-1 and GUR-3, members of the receptor family, are essential for inhibiting feeding behavior in response to light and hydrogen peroxide. PMID: 25640076
  3. Research suggests a model where LITE-1 transduces light signals in a photoreceptor neuron via G protein signaling, leading to an increase in the second messenger cGMP. This increase in cGMP then triggers the opening of cGMP-sensitive CNG channels and stimulation of photoreceptors. PMID: 20436480
Database Links

KEGG: cel:CELE_C14F11.3

STRING: 6239.C14F11.3

UniGene: Cel.802

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the AVG and PVT neurons of the tail.

Q&A

What is LITE-1 and what is its fundamental role in C. elegans?

LITE-1 is a seven-transmembrane gustatory receptor (GR) homolog that mediates UV light-induced avoidance behavior in C. elegans . Although it belongs to the gustatory receptor family, LITE-1 functions as a photoreceptor rather than a chemoreceptor. It directly absorbs both UVA and UVB light with remarkable efficiency, having an extinction coefficient 10-100 times greater than that of opsins and cryptochromes . This protein represents a distinct type of photoreceptor in the animal kingdom with unique characteristics including exceptional photoabsorption efficiency, ability to sense both UVA and UVB light, strict dependence on protein conformation for light absorption, and strong resistance to UV light bleaching .

How does the membrane topology of LITE-1 differ from conventional photoreceptors?

Unlike conventional seven-transmembrane photoreceptors such as opsins, LITE-1 adopts a reversed membrane topology . Experimental evidence using antibodies against the N- and C-termini of LITE-1 has demonstrated that the C-terminal end is located extracellularly, while the N-terminus is intracellular . This finding was further confirmed using the BiFC (Bimolecular Fluorescence Complementation) approach, where N-YFP∷ZIP attached to the N-terminus of LITE-1 complemented with C-YFP∷ZIP to reconstitute YFP fluorescence in muscle cells, demonstrating that the N-terminus is located intracellularly . This reversed topology appears to be a common feature among insect olfactory receptors (OR) and gustatory receptors (GR) .

What spectral properties characterize LITE-1 photoreception?

LITE-1 exhibits strong absorption of UV light with two distinct absorbance peaks at 280 nm and 320 nm, allowing it to capture both UVB (280-315 nm) and UVA (315-400 nm) light . The extinction coefficient of both absorbance peaks exceeds 10^6 M^-1cm^-1, which is 10-100 times greater than all known photoreceptors . This extremely high efficiency in capturing photons distinguishes LITE-1 from other photoreceptors such as bacterial rhodopsin (bRho) and bovine rhodopsin (Rho), which show much weaker photoabsorption at their signature peaks .

What structural elements are critical for LITE-1's photosensitivity?

Two tryptophan residues have been identified as critical for LITE-1's photoreceptor function . Unlike typical photoreceptor proteins that employ a prosthetic chromophore to capture photons, LITE-1 strictly depends on its protein conformation for photon absorption . Denaturing LITE-1 with urea completely abolishes its light absorption capability, eliminating both the 280 nm and 320 nm absorption peaks . This contrasts with rhodopsins, where urea treatment shifts the absorbance peak but doesn't eliminate light absorption completely, as it only releases the chromophore from the protein . Remarkably, introducing such a tryptophan residue into another GR family member can promote photosensitivity, suggesting the possibility of genetically engineering new photoreceptors .

How does the photon absorption efficiency of LITE-1 compare quantitatively to other photoreceptors?

When subjected to spectrophotometric analysis at a concentration of 0.4 μM, purified LITE-1 exhibits robust absorption of UV light, while BSA at the same concentration shows no such absorption . In comparative studies, bacterial rhodopsin (bRho) displayed minimal absorption at its signature peak of 568 nm at the same concentration, and even at 10× concentration (4 μM), its absorption remained substantially weaker than that of LITE-1 . The extinction coefficient of LITE-1's absorbance peaks exceeds 10^6 M^-1cm^-1, which is 10-100 times greater than all known photoreceptors, indicating its exceptional efficiency in capturing photons . Side-by-side purification of bovine rhodopsin (Rho) and LITE-1 under identical conditions further confirmed this dramatic difference in photoabsorption efficiency .

How does protein denaturation affect LITE-1's spectral properties?

Denaturation studies provide critical insights into LITE-1's photoreception mechanism. When treated with urea, LITE-1 completely loses its light absorption capabilities, with both the 280 nm and 320 nm peaks disappearing . This contrasts sharply with bacterial rhodopsin (bRho), where the same urea treatment merely shifts the absorbance peak from 568 nm to 370 nm, which represents the signature peak of free retinal (the chromophore of bRho) . Similarly, denatured bovine rhodopsin shows a shift in absorbance peak rather than complete elimination . These findings demonstrate that LITE-1's photoabsorption is strictly dependent on its protein conformation, unlike rhodopsins which use a prosthetic chromophore .

What purification methods are effective for obtaining functional recombinant LITE-1?

Researchers have successfully purified LITE-1 to homogeneity using affinity purification with the 1D4 antibody . After testing several monoclonal antibodies against small affinity tags (Myc, FLAG, and 1D4), the 1D4 antibody proved most efficient for purifying this membrane protein . The purity of isolated LITE-1 can be verified using SDS-PAGE followed by coomassie staining, Western blot, and silver staining . This approach allows for subsequent spectrophotometric analysis to assess LITE-1's photoabsorption properties . When designing purification protocols, it's important to preserve the protein's native conformation, as denaturing conditions completely abolish its photoreceptor function .

What functional assays can verify LITE-1 activity in heterologous expression systems?

Several complementary approaches can verify functional LITE-1 expression:

  • Behavioral assays: In C. elegans, ectopic expression of LITE-1 in body-wall muscles confers UV light sensitivity, resulting in muscle contraction and body paralysis upon UV illumination .

  • Calcium imaging: Using genetically-encoded calcium sensors such as RCaMP provides more direct and quantitative evidence of LITE-1 function. UV illumination induces robust calcium transients in muscle cells expressing LITE-1, but not in control muscle cells .

  • Membrane topology verification: BiFC (Bimolecular Fluorescence Complementation) can confirm proper membrane insertion and topology. N-YFP∷ZIP attached to the N-terminus of LITE-1 complementing with C-YFP∷ZIP to reconstitute YFP fluorescence verifies the intracellular location of the N-terminus .

These functional assays collectively demonstrate that LITE-1 can confer photosensitivity to otherwise photo-insensitive cells, highlighting its potential as an optogenetic tool .

What experimental design approaches are appropriate for studying LITE-1 properties?

When designing experiments to characterize LITE-1, researchers should consider several experimental design approaches:

How should researchers present LITE-1 study populations and results in scientific publications?

When reporting LITE-1 research, Table 1 should effectively communicate study design and potential threats to internal and external validity . For LITE-1 studies:

  • Basic structure: Include a column with descriptive statistics for the total study sample, with rows containing key study variables (minimally all variables in the final analysis) .

  • Design-specific modifications: Expand the basic structure based on study design to provide more insight regarding threats to both internal and external validity .

  • For interaction studies: When investigating how different factors interact with LITE-1 function, present data within additional strata of the relevant variables rather than across the entire sample . Show distributions of all variables according to strata of both the exposure and the modifier .

  • Descriptive statistics: Present categorical variables as n (%) and continuous variables as mean (standard deviation) or median (25th-75th percentile) .

What approaches can address missing data in LITE-1 functional studies?

Missing data in LITE-1 studies can threaten both internal and external validity. Researchers should:

  • Document missingness patterns: In Table 1, show the proportion of missing values for key variables across comparison groups to assess potential selection bias .

  • Consider multiple imputation: For handling missing data in LITE-1 functional studies, multiple imputation can be used, but researchers should clearly report imputation methods .

  • Sensitivity analysis: Compare complete case analysis with results from imputation approaches to assess robustness of findings .

  • Balance comprehensiveness with clarity: When reporting results with missing data, balance providing thorough information about missing data patterns with maintaining reader-friendly presentation .

How can LITE-1 be leveraged as an optogenetic tool?

LITE-1 shows promise as a novel optogenetic tool due to several advantageous properties:

  • Heterologous expression: LITE-1 can be functionally expressed in non-photosensitive cells such as muscles, conferring photosensitivity to these otherwise photo-insensitive cells .

  • Functional outputs: When expressed in muscle cells, UV illumination induces robust calcium transients and muscle contractions, demonstrating LITE-1's ability to couple light detection with cellular responses .

  • High photoabsorption efficiency: LITE-1's exceptional efficiency in capturing photons (10-100 times that of opsins) could potentially allow for activation with lower light intensities .

  • UV sensitivity: LITE-1's ability to sense both UVA and UVB light provides a different spectral sensitivity compared to existing optogenetic tools .

  • Engineering potential: The identification of critical tryptophan residues that can confer photosensitivity when introduced into other GR family members opens possibilities for engineering new photoreceptors with tailored properties .

What are the critical considerations for creating LITE-1 variants with modified properties?

When engineering LITE-1 variants with modified properties:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.