Recombinant Hirame rhabdovirus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-508
Protein Length
full length protein
Species
Hirame rhabdovirus (strain Korea/CA 9703/1997) (HIRRV)
Target Names
G
Target Protein Sequence
QTIKPGVDSVSDQPTWANPLFTYPVDCPAAKLSKVSPSQLRCPRIFDDENRGLVAYPAVI RSLSVGNNLGDIHTQGEYVHKVLYRTTCSTGFFGGQTIEKALVEMKLAPREVGVYDTTTA SALYFPAPRCQWYTDNVHNDLTFYYTTAKSVLRDPYTLGFLDSDFIEGKCSKSPCQTHWS NVVWKGDSGVAACDTGSEIKGHIFVDKTSHHVVKATSYGHHPWGLHRACMITFCGKPWIR TDLGDLIAIEYNGGATLLAFPACKDTTVGMRGSLDDFAYLDDLVKSSESREECLEAHAEI IATNSVTPYLLSKFRSPHPGINDVYAMHDGSIYHGKCMTVAIDEVSKDRRTYRAHQTSAF VAWGHPFGDEWGGFHGLHGNDTPVIPDLEKYVAQYKVSMMDKMDIRPVPHPSVQILYNDT DTADITIRKIDSFDLQSLNWSFWPSLSALGGVPILLALVFFLYCCMNRRPSMPAAPQEIP MYHLASRG
Uniprot No.

Target Background

Function

The Hirame rhabdovirus glycoprotein G (G) mediates viral attachment to the host cell receptor, triggering virion endocytosis. Within the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, resulting in fusion between the viral and cellular membranes.

Database Links

KEGG: vg:2559534

Protein Families
Novirhabdovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure of HIRRV Glycoprotein G?

HIRRV Glycoprotein G is a type I membrane glycoprotein composed of 508 amino acids, encoded by a gene sequence comprising 1612 nucleotides . As with other rhabdoviral glycoproteins, it functions as a trimeric spike protein projecting from the viral envelope . The protein contains an N-terminal ectodomain, a single α-helical transmembrane segment for membrane anchoring, and a small intraviral domain that likely interacts with internal viral proteins . The molecular weight of recombinant HIRRV-G produced in expression systems such as Lactococcus lactis with a LysM anchoring motif is approximately 81 kDa .

What are the primary immunogenic characteristics of HIRRV-G protein?

HIRRV-G protein is considered a crucial antigenic determinant in rhabdoviruses and is almost the only protein that elicits neutralization antibodies . Studies have demonstrated that HIRRV-G can trigger both mucosal and humoral immune responses in fish. When used as an immunogen, it elicits specific IgM production against HIRRV in both gut mucus and serum of vaccinated fish . The immunogenic nature of HIRRV-G has been confirmed through various vaccine formulations including subunit vaccines, DNA vaccines, and recombinant bacteria-based vaccines, all demonstrating considerable protective effects against HIRRV infection .

How does HIRRV-G compare structurally to glycoproteins of other rhabdoviruses?

In sequence comparison analyses of 15 rhabdovirus glycoproteins, HIRRV-G showed moderate sequence conservation. It demonstrated the highest amino acid sequence identity (31.2-33.2%) with vesicular stomatitis viruses including VSNJV, CHPV, and VSIV . Despite this relatively low sequence identity, functional domains are conserved across rhabdoviral glycoproteins, as they all mediate both receptor recognition and membrane fusion processes . Like other rhabdoviral glycoproteins, HIRRV-G likely undergoes conformational changes triggered by low pH during endosomal entry, facilitating membrane fusion between viral and cellular membranes .

What expression systems have been successfully used for recombinant HIRRV-G production?

Several expression systems have been utilized for HIRRV-G production, with varying advantages:

  • Bacterial expression (E. coli): Used primarily for analytical studies and antibody production. Research has demonstrated successful expression of HIRRV-G in E. coli Transetta with the pET-28a system for generating polyclonal antibodies .

  • Lactic acid bacteria (Lactococcus lactis): Successfully employed for surface display of HIRRV-G using the NZ9000 strain. This system is particularly valuable for oral vaccine development due to L. lactis being a generally recognized as safe (GRAS) organism that can survive passage through the gastrointestinal tract .

  • DNA vaccine vectors: While not directly producing recombinant protein, DNA vaccines encoding HIRRV-G have shown high protection levels in fish challenge studies .

The choice of expression system depends on the intended application, with bacterial surface display showing particular promise for oral vaccine development.

What are the methodological approaches for confirming successful expression and surface display of recombinant HIRRV-G?

Verification of successful HIRRV-G expression and surface display involves multiple complementary techniques:

  • SDS-PAGE and Western blotting: To confirm protein expression and approximate molecular weight. For HIRRV-G expressed with LysM anchoring motif in L. lactis, an approximately 81 kDa band is expected .

  • Mass spectrometry analysis: For precise protein identification and confirmation of amino acid sequence .

  • Immunofluorescence assay (IFA): To visualize surface-displayed G protein on bacterial cells. Specific green fluorescence should be observable on the surface of recombinant bacteria .

  • Flow cytometry (FCM): For quantitative assessment of surface display efficiency. Studies have shown that properly induced L. lactis expressing HIRRV-G can achieve over 85% positive display after 3 hours of induction .

  • Double immunofluorescence staining: Particularly useful for in vivo localization studies, allowing visualization of both the recombinant bacteria and the displayed G protein in tissue samples from immunized animals .

What experimental design considerations are critical when developing HIRRV-G based vaccines?

When designing experiments for HIRRV-G vaccine development, researchers should consider:

  • Selection of expression system: Based on the intended route of administration (oral vs. injectable), target species, and scalability requirements.

  • Antigen delivery format: Options include purified protein (subunit vaccine), DNA vaccines, or recombinant bacterial display systems. Each has different advantages for immunogenicity, stability, and administration routes.

  • Dose optimization: For oral vaccines using recombinant L. lactis, effective protocols have used commercial diet pellets coated with 1.0 × 10^9 cfu/g of induced bacteria .

  • Vaccination schedule: A prime-boost strategy has shown efficacy, with initial vaccination followed by booster immunization after four weeks .

  • Control groups: Essential controls include groups receiving the expression vector without the antigen, the bacterial host without recombinant plasmid, and buffer-only treatments .

  • Sampling timeline and locations: For comprehensive immune response evaluation, sampling should include both mucosal (gut mucus) and systemic (serum) compartments at multiple timepoints (e.g., weeks 2, 4, 6 post-immunization) .

Optimization of L. lactis-based HIRRV-G oral vaccines should address several key variables:

  • Surface display efficiency: Using strong inducible promoters (e.g., nisin-inducible system) and optimizing induction conditions. Flow cytometry has shown that optimization can achieve >85% surface display efficiency .

  • Feed incorporation method: Commercial diet pellets coated with recombinant bacteria have proven effective. The coating process should preserve bacterial viability while ensuring adequate adherence to feed .

  • Feeding duration: Studies have used a 1-week continuous feeding protocol, which resulted in approximately 10^4-10^5 recombinant L. lactis cells per gram of intestinal tissue (foregut, midgut, hindgut) one day after feeding cessation .

  • Bacterial persistence monitoring: Tracking bacterial survival in the fish intestine reveals that recombinant L. lactis localizes primarily at the bottom of the gut mucus layer, near the intestinal epithelial cells, with some bacteria penetrating the epithelial layer. By day 21 post-feeding, approximately 10^2-10^3 L. lactis cells can still be recovered from intestinal samples .

  • Booster immunization timing: Four weeks after initial immunization appears effective for enhancing antibody responses .

How can researchers assess the functional roles of specific domains within HIRRV-G protein?

Investigating domain-specific functions of HIRRV-G requires strategic approaches:

  • Site-directed mutagenesis: Targeting conserved residues identified through sequence alignment with other rhabdovirus G proteins, particularly focusing on regions involved in:

    • Receptor binding

    • Fusion peptide activity

    • pH-dependent conformational changes

    • Oligomerization interfaces

  • Chimeric protein construction: Creating fusion proteins or domain swaps between HIRRV-G and other well-characterized rhabdoviral glycoproteins to elucidate domain functions.

  • Truncation analysis: Expressing fragments of the G protein to identify minimal regions required for specific functions or immunogenicity.

  • Structural prediction and validation: Using comparative modeling based on the solved structures of related rhabdoviral G proteins (e.g., VSV G) to predict structural features unique to HIRRV-G, followed by experimental validation.

  • Antibody epitope mapping: Generating monoclonal antibodies against HIRRV-G and characterizing their binding sites to identify immunodominant regions.

What cellular receptors and entry mechanisms are utilized by HIRRV, and how does recombinant G protein interact with them?

While specific receptors for HIRRV are not fully characterized in the provided search results, insights can be drawn from related rhabdoviruses:

  • Potential receptor candidates: Based on studies of other rhabdoviruses, potential receptor types may include:

    • Phospholipids: Host cell treatment with phospholipases has been shown to reduce binding of some rhabdoviruses

    • Gangliosides: Highly sialylated gangliosides like GT1b and GQ1b have been implicated in rhabdovirus receptor structure

    • Protein receptors: For related rhabdoviruses, proteins such as nicotinic acetylcholine receptor (nAChR) have been proposed as receptors

  • Entry mechanism: As a rhabdovirus, HIRRV likely enters cells via the endocytic pathway, with G protein mediating both receptor binding and subsequent membrane fusion within the acidic environment of endosomes .

  • Conformational changes: The G protein likely undergoes pH-dependent conformational rearrangement similar to other rhabdoviruses, transitioning between pre- and post-fusion states .

  • Experimental approaches to study these interactions:

    • Receptor blocking assays using recombinant G protein

    • Cell-binding assays with fluorescently labeled recombinant G

    • pH-dependent fusion assays using model membrane systems

How can researchers develop quantitative assays to measure the immunogenicity and protective efficacy of different HIRRV-G constructs?

For precise comparisons between different HIRRV-G vaccine formulations, standardized quantitative assays are essential:

  • Standardized ELISA protocols: Development of a quantitative ELISA using purified recombinant HIRRV-G as a standard to enable absolute quantification of specific antibody levels across studies.

  • Virus neutralization assays: Quantifying the neutralizing capacity of antibodies induced by different vaccine constructs using standardized cell culture systems.

  • Challenge dose determination: Establishing LD50 (lethal dose, 50%) for HIRRV in the target species to standardize challenge studies.

  • Quantitative PCR for viral load: Using standard curves based on plasmids containing HIRRV genes for absolute quantification of viral copy numbers in tissues following challenge, as demonstrated in previous studies :

Standard curve equation: y = -3.6984x + 41.964, R² = 0.9996
where y = threshold cycle (Ct) and x = log of standard plasmid copy numbers

Protocol details:

  • RNA extraction from spleen samples (0.1 μg RNA)

  • Reverse transcription

  • qPCR using SYBR Green I Master

  • Cycling conditions: 95°C for 10 min, followed by 40 cycles at 95°C for 30 s and 60°C for 1 min

  • Results expressed as mean log₁₀ copies/0.1 μg RNA

  • Immune correlates of protection: Identification of specific immune parameters (antibody titers, cellular responses) that correlate with protection, enabling more rapid evaluation of new vaccine candidates.

How does HIRRV-G compare with glycoproteins from other fish rhabdoviruses in terms of immunogenicity and vaccine potential?

Comparative analysis reveals similarities and differences between HIRRV-G and other fish rhabdovirus glycoproteins:

What advanced expression systems could enhance recombinant HIRRV-G production for research and vaccine development?

While L. lactis surface display has shown promise for oral vaccine development, researchers should consider several alternative or improved expression platforms:

  • Eukaryotic expression systems: Yeast, insect cells, or fish cell lines may provide more authentic glycosylation patterns than bacterial systems, potentially enhancing immunogenicity.

  • Plant-based expression: Transgenic plants or plant viral vectors could enable cost-effective production of HIRRV-G for oral delivery.

  • Improved bacterial surface display technologies:

    • Optimization of signal peptides and anchoring domains

    • Codon optimization for higher expression levels

    • Fusion with adjuvant molecules to enhance immunogenicity

    • Co-expression with immune stimulatory molecules

  • Nanoparticle and VLP (virus-like particle) platforms: Incorporation of HIRRV-G into nanoparticles or VLPs could enhance stability, immunogenicity, and targeted delivery.

  • Multivalent vaccine approaches: Co-expression of HIRRV-G with antigens from other fish pathogens could enable development of combination vaccines protecting against multiple diseases.

What are the common challenges in recombinant HIRRV-G expression and how can researchers address them?

Researchers working with recombinant HIRRV-G may encounter several technical challenges:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host

    • Solution: Test different promoters and expression conditions

    • Solution: Consider fusion partners that enhance solubility and expression

  • Protein misfolding:

    • Solution: Ensure proper glycosylation, as N-glycosylation has been shown to be important for proper folding of rhabdoviral glycoproteins

    • Solution: Express in eukaryotic systems that support proper post-translational modifications

    • Solution: Optimize folding conditions (temperature, oxidizing environment)

  • Surface display efficiency in bacterial systems:

    • Solution: Optimize induction conditions (timing, inducer concentration)

    • Solution: Test different cell wall anchoring domains beyond LysM

    • Solution: Flow cytometry assessment can help quantify display efficiency, with optimized systems achieving >85% positive cells

  • Protein degradation:

    • Solution: Include protease inhibitors during purification

    • Solution: Optimize extraction and purification protocols to minimize exposure to proteases

  • Antigenic variation between HIRRV strains:

    • Solution: Sequence analysis of multiple isolates to identify conserved regions

    • Solution: Design constructs based on consensus sequences or conserved epitopes

How can researchers optimize immune response measurements to accurately assess HIRRV-G vaccine efficacy?

Comprehensive immune response assessment requires attention to several methodological details:

  • Sampling considerations:

    • Multiple timepoints are essential (e.g., weeks 2, 4, 6 post-immunization)

    • Both local (mucosal) and systemic compartments should be sampled

    • For fish studies, gut mucus, skin mucus, gill tissue, spleen, and serum are relevant sample types

  • ELISA protocol optimization:

    • Use purified recombinant HIRRV-G as coating antigen

    • Optimize blocking conditions to minimize background

    • Include multiple dilutions of samples to ensure readings fall within the linear range

    • Use species-specific secondary antibodies (e.g., anti-fish IgM)

  • Cellular immune response assessment:

    • Consider techniques to measure T-cell responses, not just antibody production

    • Flow cytometry analysis of lymphocyte populations in immunized animals

    • Cytokine expression analysis in relevant tissues

  • Challenge study design:

    • Determine appropriate challenge dose through preliminary studies

    • Consider natural infection routes when possible

    • Monitor multiple parameters: survival, clinical signs, viral load, tissue pathology

    • Implement standardized scoring systems for clinical signs and pathology

  • Statistical analysis approaches:

    • One-way ANOVA for comparing antibody production and viral copies between groups

    • Log-rank (Mantel-Cox) test for survival rate comparisons

    • Express results as mean ± SD with significance level defined as p < 0.05

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.