Recombinant His1 virus Putative transmembrane protein ORF13 (ORF13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant His1 Virus Putative Transmembrane Protein ORF13

The recombinant His1 virus putative transmembrane protein ORF13 (ORF13) is a bioengineered version of a viral protein encoded by the Haloarcula hispanica virus 1 (His1V). This protein is part of a linear double-stranded DNA genome (14.5 kb) that encodes 35 open reading frames (ORFs) involved in viral replication, structural assembly, and host interactions . ORF13 is classified as a transmembrane protein, suggesting potential roles in viral envelope formation, membrane trafficking, or host-virus interactions. The recombinant form is produced in E. coli and includes an N-terminal His-tag for purification and functional studies .

Amino Acid Sequence and Domains

ORF13 spans 99 amino acids (1–99 aa) with the sequence:
MNYWHSAIATFGIGDTVTTIIGLSMAGIYEANPAANTILGELGLFGIIAAKVLYFGLMYIIVKSMPEHSRKYGPITITVLGTLICLWNIAIIATQVLGF .
Key features include:

  • Hydrophobic regions: Likely contribute to membrane anchoring.

  • Conserved motifs: Putative transmembrane helices (e.g., residues 1–99).

  • Post-translational modifications: None explicitly reported, but the His-tag facilitates affinity chromatography .

Expression and Purification

ParameterDetail
Host organismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage bufferTris/PBS-based buffer, 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 50% glycerol for stability
StabilityAliquot storage at -20°C/-80°C; avoid freeze-thaw cycles .

Research Utility

The recombinant ORF13 is employed in:

  • Structural studies: Cryo-EM or X-ray crystallography to resolve transmembrane domains .

  • Interaction assays: Co-IP or pull-down experiments to identify host/viral binding partners.

  • Antiviral drug screening: Testing membrane-targeted inhibitors .

Genome Organization of His1 Virus

FeatureDetail
Genome typeLinear dsDNA (14.5 kb) with covalently bound terminal proteins .
ORFs35, including ORF13, polymerases (type B), and structural proteins.
Replication mechanismProtein-priming at both genomic termini .
Viral releaseBudding from host S-layers without cell lysis .

Comparative Analysis

ORF13 shares structural similarities with transmembrane proteins in:

  • Salterproviruses: Terminal protein-primed replication .

  • Haloarchaeal viruses: S-layer interactions during virion assembly .

Table 2: His1 Virus Genome Features

FeatureDetail
Genome Size14.5 kb
Terminal Repeats105 bp inverted repeats
ORFs35, including ORF13, DNA polymerase, and ATPases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF13; Putative transmembrane protein ORF13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)
Target Names
ORF13
Target Protein Sequence
MNYWHSAIATFGIGDTVTTIIGLSMAGIYEANPAANTILGELGLFGIIAAKVLYFGLMYI IVKSMPEHSRKYGPITITVLGTLICLWNIAIIATQVLGF
Uniprot No.

Target Background

Database Links

KEGG: vg:5142403

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for confirming the transmembrane nature of viral proteins like ORF13?

The confirmation of transmembrane domains in viral proteins requires multiple complementary approaches. For viral transmembrane proteins, researchers typically employ computational prediction tools combined with experimental validation. Computational methods include hydrophobicity analysis, transmembrane prediction algorithms (TMHMM, SOSUI), and structural homology modeling. Experimentally, researchers use protease protection assays, selective membrane permeabilization, and fluorescence microscopy with tagged proteins.

Similar approaches have been documented in studies of other archaeal viruses, where transmembrane domains were detected in structural proteins. For example, in HFPV-1 (Haloferax volcanii pleomorphic virus 1), researchers identified transmembrane domains in ORF6 and ORF7 proteins, which were subsequently detected in virions through mass spectrometry analyses .

What expression systems are most suitable for recombinant viral transmembrane proteins?

The expression of archaeal viral transmembrane proteins presents unique challenges due to their hydrophobic nature and potential toxicity to expression hosts. When working with proteins like ORF13, researchers typically consider several expression systems:

  • Bacterial expression systems: Modified E. coli strains (C41, C43) designed for membrane protein expression

  • Yeast expression systems: Pichia pastoris for eukaryotic membrane proteins

  • Insect cell systems: Baculovirus expression vectors for complex membrane proteins

  • Cell-free expression systems: For toxic proteins that disrupt cellular membranes

The choice depends on research objectives - structural studies require high yields of purified protein, while functional studies may require proper folding and post-translational modifications. For archaeal virus proteins specifically, using archaeal host expression systems may provide better folding environments due to compatible membrane composition.

How can researchers isolate and purify transmembrane viral proteins while maintaining structural integrity?

Isolation of viral transmembrane proteins requires specialized techniques to maintain their native structure. Based on methodologies used for similar viral proteins, a multi-step approach is recommended:

  • Membrane solubilization: Use mild detergents (DDM, LMNG) to extract proteins from membranes

  • Affinity chromatography: Engineer affinity tags (His, FLAG) for initial purification

  • Size exclusion chromatography: For final purification and buffer exchange

Critical considerations include:

  • Detergent concentration must be maintained above CMC throughout purification

  • Addition of lipids during purification may stabilize protein structure

  • Temperature control is essential to prevent aggregation

Similar approaches have been successful with other viral transmembrane proteins, as demonstrated in studies of haloarchaeal viruses where researchers used these techniques to isolate structural proteins for mass spectrometry analysis .

What strategies can be employed to study ORF13 protein-protein interactions within the viral structure?

Investigating protein-protein interactions for viral transmembrane proteins requires specialized approaches due to their hydrophobic nature. Based on successful studies with similar viral proteins, researchers should consider:

  • Co-immunoprecipitation with crosslinking: Chemical crosslinkers can stabilize transient interactions before solubilization

  • FRET/BRET assays: For studying interactions in intact membranes

  • Proximity labeling techniques: BioID or APEX2 to identify neighboring proteins

  • Split reporter assays: BiFC for visualizing interactions in living cells

When designing interaction studies, researchers should consider both homotypic interactions (ORF13-ORF13) and heterotypic interactions with other viral and host proteins. Recent studies on haloarchaeal viruses have shown that structural proteins often form complex interaction networks essential for virus assembly and function .

How can tagged versions of ORF13 be utilized to track viral assembly processes?

Tagging viral transmembrane proteins requires careful consideration to avoid disrupting protein function. Based on successful approaches with other viral proteins, researchers should:

  • Select appropriate tags: Small epitope tags (HA, FLAG, V5) or fluorescent proteins (mCherry, GFP)

  • Determine optimal tag position: N-terminal, C-terminal, or internal tagging based on structural predictions

  • Validate tag functionality: Confirm tagged protein retains function through complementation assays

Recent advances with HEV have demonstrated the successful insertion of epitope tags and functional reporters within the ORF1 protein, enabling visualization of viral replication complexes in cytoplasmic dot-like structures that partially overlap with other viral proteins . Similar approaches could be applied to ORF13, potentially revealing its spatial and temporal distribution during viral assembly.

What methodological approaches are most effective for studying the role of ORF13 in viral host specificity?

Understanding the role of transmembrane proteins in viral host range requires systematic approaches:

  • Domain swap experiments: Replace ORF13 domains with corresponding regions from related viruses with different host ranges

  • Site-directed mutagenesis: Target conserved residues in putative receptor-binding regions

  • Host receptor identification: Use ORF13 as bait in pull-down experiments with host membrane proteins

  • Cryo-EM structural studies: Determine protein structure in complex with host receptors

The methodological approach should include functional assays to measure virus attachment and entry efficiency across different host species. Similar methodologies have revealed insights into host range determinants in other archaeal viruses, such as PH1, which was shown to transfect haloarchaeal species belonging to five different genera .

What techniques are most appropriate for determining the 3D structure of ORF13?

Structural determination of viral transmembrane proteins presents significant challenges. Based on current methodologies, researchers should consider:

TechniqueResolutionSample RequirementsAdvantagesLimitations
X-ray CrystallographyAtomicCrystallizable protein; mg quantitiesHighest resolutionDifficult to crystallize membrane proteins
Cryo-EMNear-atomicμg quantities; no crystals neededWorks with heterogeneous samplesLower resolution for small proteins
NMR SpectroscopyAtomicIsotope-labeled protein; mg quantitiesDynamic informationSize limitations (≤30 kDa optimal)
MD SimulationAtomicInitial structural modelDynamics in membrane environmentRequires experimental validation

Given the challenges, a hybrid approach is often most successful, combining experimental data with computational modeling. Researchers studying viral capsid proteins have successfully employed mass spectrometry to identify structural proteins and determine their organization, as demonstrated in studies of PH1 virus where MS analysis identified VP1-4, VP7, VP9, VP10, and VP12 as key structural components .

How does the membrane environment affect ORF13 function and what methods can assess this relationship?

The interaction between viral transmembrane proteins and host membranes is critical for function. Based on methodologies used for similar viral systems, researchers should investigate:

  • Lipid composition effects: Reconstitute ORF13 in liposomes with varying lipid compositions to assess functional changes

  • Membrane curvature sensitivity: Use differently sized liposomes to test curvature effects

  • Cholesterol dependence: Deplete/supplement membranes with cholesterol to assess functional impact

  • Lateral mobility measurements: FRAP or single-molecule tracking to measure diffusion in different membrane environments

For archaeal viruses specifically, the unique lipid composition of archaeal hosts may significantly influence protein function. Studies of haloarchaeal viruses have shown that viral stability is highly dependent on salt concentration, which affects membrane properties . Researchers working with ORF13 should consider these environmental factors when designing functional assays.

What are the most reliable approaches for distinguishing between structural and functional roles of ORF13?

Determining whether a viral transmembrane protein serves primarily structural or functional roles requires systematic investigation:

  • Complementation assays: Create ORF13 deletion mutants and test rescue with wild-type or mutant versions

  • Dominant negative mutants: Express non-functional ORF13 variants in infected cells

  • Time-of-addition experiments: Block ORF13 function at different stages of viral lifecycle

  • Structural incorporation assessment: Quantify ORF13 copy number in virions using quantitative mass spectrometry

Researchers should design experiments that separately assess structural integrity (does the virus assemble properly?) and functional activity (can the virus attach, enter, or exit cells?). Studies of other viral systems have employed these approaches, for example with Hepatitis E virus where researchers found that specific proteins play critical roles in viral entry mechanisms .

How can researchers investigate the role of ORF13 in the context of viral lifecycle without disrupting other viral functions?

Studying individual viral proteins within the complex viral lifecycle presents significant challenges. Based on successful approaches with other viral systems, researchers should consider:

  • Inducible expression systems: Control timing of ORF13 expression during infection

  • Trans-complementation: Supply functional ORF13 from alternative expression systems

  • Temperature-sensitive mutants: Create conditional mutants for temporal studies

  • CRISPR interference: Partial knockdown of expression rather than complete deletion

The selection of appropriate methodologies depends on specific research questions. For lifecycle studies, single-step growth curve analysis combined with quantitative measurements of viral components can reveal the stage at which ORF13 functions. Similar approaches have been used to study other viral systems, such as HFPV-1, where researchers performed long-term experiments to study stable virus-host relationships and viral persistence .

What experimental approaches can determine if ORF13 interacts with host cell proteins during infection?

Identifying virus-host protein interactions is critical for understanding viral pathogenesis. Based on current methodologies, researchers should:

  • Affinity purification-mass spectrometry: Use tagged ORF13 to pull down interacting host proteins

  • Yeast two-hybrid screening: Screen against host protein libraries

  • Protein microarrays: Probe arrays of host proteins with purified ORF13

  • Proximity labeling: Express ORF13 fused to BioID or APEX2 in host cells

When analyzing potential interactions, researchers should consider the membrane localization of ORF13 and focus on host membrane proteins or peripheral membrane proteins. Studies of other viral systems have revealed important virus-host interactions, such as the dependence of both enveloped and non-enveloped forms of Hepatitis E virus on host factors like Rab13, PKA, and ZO-1 for viral entry .

How can researchers address the challenges of studying viral proteins that might be toxic when expressed in heterologous systems?

Viral transmembrane proteins often exhibit toxicity when expressed in laboratory host systems. Based on solutions developed for similar proteins:

  • Tightly regulated expression systems: Use tightly controlled promoters (tet-inducible systems)

  • Cell-free expression: Avoid cellular toxicity altogether

  • Fusion protein strategies: Express as fusion with soluble partners to reduce toxicity

  • Native host expression: Express in the virus's natural host if possible

Additional considerations include using lower incubation temperatures to slow protein production and codon optimization for the expression host. These approaches have been successfully employed in studies of other challenging viral proteins and can be adapted for ORF13 research.

How should researchers approach comparative analysis of ORF13 with related proteins from different archaeal viruses?

Comparative analysis provides valuable context for understanding protein function. For researchers studying ORF13, a systematic approach should include:

  • Sequence-based comparisons: Multiple sequence alignments and phylogenetic analysis

  • Structure-based comparisons: Homology modeling based on related proteins

  • Functional domain conservation: Identification of conserved functional motifs

  • Synteny analysis: Compare genomic context of ORF13 homologs

Studies of archaeal viruses have demonstrated the value of comparative approaches, revealing evolutionary relationships between viruses infecting different archaeal hosts. For example, research on PH1 and SH1 viruses demonstrated 74% nucleotide identity, allowing detailed analysis of divergent regions and detection of repeat-mediated deletions . Similar approaches could reveal key functional domains within ORF13.

What methods are most effective for analyzing post-translational modifications of ORF13?

Post-translational modifications (PTMs) often regulate viral protein function. Researchers investigating ORF13 PTMs should consider:

  • Mass spectrometry-based approaches:

    • Enrichment strategies for specific modifications

    • Top-down proteomics for intact protein analysis

    • Multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage

  • Site-directed mutagenesis of putative modification sites

  • In vitro modification assays with host enzymes

Research on other viral proteins has demonstrated that PTMs can significantly impact viral assembly, host interactions, and immune evasion. When studying archaeal viral proteins specifically, researchers should consider the unique PTM systems present in archaeal hosts, which may differ from bacterial and eukaryotic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.