The recombinant His1 virus putative transmembrane protein ORF13 (ORF13) is a bioengineered version of a viral protein encoded by the Haloarcula hispanica virus 1 (His1V). This protein is part of a linear double-stranded DNA genome (14.5 kb) that encodes 35 open reading frames (ORFs) involved in viral replication, structural assembly, and host interactions . ORF13 is classified as a transmembrane protein, suggesting potential roles in viral envelope formation, membrane trafficking, or host-virus interactions. The recombinant form is produced in E. coli and includes an N-terminal His-tag for purification and functional studies .
ORF13 spans 99 amino acids (1–99 aa) with the sequence:
MNYWHSAIATFGIGDTVTTIIGLSMAGIYEANPAANTILGELGLFGIIAAKVLYFGLMYIIVKSMPEHSRKYGPITITVLGTLICLWNIAIIATQVLGF .
Key features include:
Hydrophobic regions: Likely contribute to membrane anchoring.
Conserved motifs: Putative transmembrane helices (e.g., residues 1–99).
Post-translational modifications: None explicitly reported, but the His-tag facilitates affinity chromatography .
The recombinant ORF13 is employed in:
Structural studies: Cryo-EM or X-ray crystallography to resolve transmembrane domains .
Interaction assays: Co-IP or pull-down experiments to identify host/viral binding partners.
Antiviral drug screening: Testing membrane-targeted inhibitors .
ORF13 shares structural similarities with transmembrane proteins in:
KEGG: vg:5142403
The confirmation of transmembrane domains in viral proteins requires multiple complementary approaches. For viral transmembrane proteins, researchers typically employ computational prediction tools combined with experimental validation. Computational methods include hydrophobicity analysis, transmembrane prediction algorithms (TMHMM, SOSUI), and structural homology modeling. Experimentally, researchers use protease protection assays, selective membrane permeabilization, and fluorescence microscopy with tagged proteins.
Similar approaches have been documented in studies of other archaeal viruses, where transmembrane domains were detected in structural proteins. For example, in HFPV-1 (Haloferax volcanii pleomorphic virus 1), researchers identified transmembrane domains in ORF6 and ORF7 proteins, which were subsequently detected in virions through mass spectrometry analyses .
The expression of archaeal viral transmembrane proteins presents unique challenges due to their hydrophobic nature and potential toxicity to expression hosts. When working with proteins like ORF13, researchers typically consider several expression systems:
Bacterial expression systems: Modified E. coli strains (C41, C43) designed for membrane protein expression
Yeast expression systems: Pichia pastoris for eukaryotic membrane proteins
Insect cell systems: Baculovirus expression vectors for complex membrane proteins
Cell-free expression systems: For toxic proteins that disrupt cellular membranes
The choice depends on research objectives - structural studies require high yields of purified protein, while functional studies may require proper folding and post-translational modifications. For archaeal virus proteins specifically, using archaeal host expression systems may provide better folding environments due to compatible membrane composition.
Isolation of viral transmembrane proteins requires specialized techniques to maintain their native structure. Based on methodologies used for similar viral proteins, a multi-step approach is recommended:
Membrane solubilization: Use mild detergents (DDM, LMNG) to extract proteins from membranes
Affinity chromatography: Engineer affinity tags (His, FLAG) for initial purification
Size exclusion chromatography: For final purification and buffer exchange
Critical considerations include:
Detergent concentration must be maintained above CMC throughout purification
Addition of lipids during purification may stabilize protein structure
Temperature control is essential to prevent aggregation
Similar approaches have been successful with other viral transmembrane proteins, as demonstrated in studies of haloarchaeal viruses where researchers used these techniques to isolate structural proteins for mass spectrometry analysis .
Investigating protein-protein interactions for viral transmembrane proteins requires specialized approaches due to their hydrophobic nature. Based on successful studies with similar viral proteins, researchers should consider:
Co-immunoprecipitation with crosslinking: Chemical crosslinkers can stabilize transient interactions before solubilization
FRET/BRET assays: For studying interactions in intact membranes
Proximity labeling techniques: BioID or APEX2 to identify neighboring proteins
Split reporter assays: BiFC for visualizing interactions in living cells
When designing interaction studies, researchers should consider both homotypic interactions (ORF13-ORF13) and heterotypic interactions with other viral and host proteins. Recent studies on haloarchaeal viruses have shown that structural proteins often form complex interaction networks essential for virus assembly and function .
Tagging viral transmembrane proteins requires careful consideration to avoid disrupting protein function. Based on successful approaches with other viral proteins, researchers should:
Select appropriate tags: Small epitope tags (HA, FLAG, V5) or fluorescent proteins (mCherry, GFP)
Determine optimal tag position: N-terminal, C-terminal, or internal tagging based on structural predictions
Validate tag functionality: Confirm tagged protein retains function through complementation assays
Recent advances with HEV have demonstrated the successful insertion of epitope tags and functional reporters within the ORF1 protein, enabling visualization of viral replication complexes in cytoplasmic dot-like structures that partially overlap with other viral proteins . Similar approaches could be applied to ORF13, potentially revealing its spatial and temporal distribution during viral assembly.
Understanding the role of transmembrane proteins in viral host range requires systematic approaches:
Domain swap experiments: Replace ORF13 domains with corresponding regions from related viruses with different host ranges
Site-directed mutagenesis: Target conserved residues in putative receptor-binding regions
Host receptor identification: Use ORF13 as bait in pull-down experiments with host membrane proteins
Cryo-EM structural studies: Determine protein structure in complex with host receptors
The methodological approach should include functional assays to measure virus attachment and entry efficiency across different host species. Similar methodologies have revealed insights into host range determinants in other archaeal viruses, such as PH1, which was shown to transfect haloarchaeal species belonging to five different genera .
Structural determination of viral transmembrane proteins presents significant challenges. Based on current methodologies, researchers should consider:
| Technique | Resolution | Sample Requirements | Advantages | Limitations |
|---|---|---|---|---|
| X-ray Crystallography | Atomic | Crystallizable protein; mg quantities | Highest resolution | Difficult to crystallize membrane proteins |
| Cryo-EM | Near-atomic | μg quantities; no crystals needed | Works with heterogeneous samples | Lower resolution for small proteins |
| NMR Spectroscopy | Atomic | Isotope-labeled protein; mg quantities | Dynamic information | Size limitations (≤30 kDa optimal) |
| MD Simulation | Atomic | Initial structural model | Dynamics in membrane environment | Requires experimental validation |
Given the challenges, a hybrid approach is often most successful, combining experimental data with computational modeling. Researchers studying viral capsid proteins have successfully employed mass spectrometry to identify structural proteins and determine their organization, as demonstrated in studies of PH1 virus where MS analysis identified VP1-4, VP7, VP9, VP10, and VP12 as key structural components .
The interaction between viral transmembrane proteins and host membranes is critical for function. Based on methodologies used for similar viral systems, researchers should investigate:
Lipid composition effects: Reconstitute ORF13 in liposomes with varying lipid compositions to assess functional changes
Membrane curvature sensitivity: Use differently sized liposomes to test curvature effects
Cholesterol dependence: Deplete/supplement membranes with cholesterol to assess functional impact
Lateral mobility measurements: FRAP or single-molecule tracking to measure diffusion in different membrane environments
For archaeal viruses specifically, the unique lipid composition of archaeal hosts may significantly influence protein function. Studies of haloarchaeal viruses have shown that viral stability is highly dependent on salt concentration, which affects membrane properties . Researchers working with ORF13 should consider these environmental factors when designing functional assays.
Determining whether a viral transmembrane protein serves primarily structural or functional roles requires systematic investigation:
Complementation assays: Create ORF13 deletion mutants and test rescue with wild-type or mutant versions
Dominant negative mutants: Express non-functional ORF13 variants in infected cells
Time-of-addition experiments: Block ORF13 function at different stages of viral lifecycle
Structural incorporation assessment: Quantify ORF13 copy number in virions using quantitative mass spectrometry
Researchers should design experiments that separately assess structural integrity (does the virus assemble properly?) and functional activity (can the virus attach, enter, or exit cells?). Studies of other viral systems have employed these approaches, for example with Hepatitis E virus where researchers found that specific proteins play critical roles in viral entry mechanisms .
Studying individual viral proteins within the complex viral lifecycle presents significant challenges. Based on successful approaches with other viral systems, researchers should consider:
Inducible expression systems: Control timing of ORF13 expression during infection
Trans-complementation: Supply functional ORF13 from alternative expression systems
Temperature-sensitive mutants: Create conditional mutants for temporal studies
CRISPR interference: Partial knockdown of expression rather than complete deletion
The selection of appropriate methodologies depends on specific research questions. For lifecycle studies, single-step growth curve analysis combined with quantitative measurements of viral components can reveal the stage at which ORF13 functions. Similar approaches have been used to study other viral systems, such as HFPV-1, where researchers performed long-term experiments to study stable virus-host relationships and viral persistence .
Identifying virus-host protein interactions is critical for understanding viral pathogenesis. Based on current methodologies, researchers should:
Affinity purification-mass spectrometry: Use tagged ORF13 to pull down interacting host proteins
Yeast two-hybrid screening: Screen against host protein libraries
Protein microarrays: Probe arrays of host proteins with purified ORF13
Proximity labeling: Express ORF13 fused to BioID or APEX2 in host cells
When analyzing potential interactions, researchers should consider the membrane localization of ORF13 and focus on host membrane proteins or peripheral membrane proteins. Studies of other viral systems have revealed important virus-host interactions, such as the dependence of both enveloped and non-enveloped forms of Hepatitis E virus on host factors like Rab13, PKA, and ZO-1 for viral entry .
Viral transmembrane proteins often exhibit toxicity when expressed in laboratory host systems. Based on solutions developed for similar proteins:
Tightly regulated expression systems: Use tightly controlled promoters (tet-inducible systems)
Cell-free expression: Avoid cellular toxicity altogether
Fusion protein strategies: Express as fusion with soluble partners to reduce toxicity
Native host expression: Express in the virus's natural host if possible
Additional considerations include using lower incubation temperatures to slow protein production and codon optimization for the expression host. These approaches have been successfully employed in studies of other challenging viral proteins and can be adapted for ORF13 research.
Comparative analysis provides valuable context for understanding protein function. For researchers studying ORF13, a systematic approach should include:
Sequence-based comparisons: Multiple sequence alignments and phylogenetic analysis
Structure-based comparisons: Homology modeling based on related proteins
Functional domain conservation: Identification of conserved functional motifs
Synteny analysis: Compare genomic context of ORF13 homologs
Studies of archaeal viruses have demonstrated the value of comparative approaches, revealing evolutionary relationships between viruses infecting different archaeal hosts. For example, research on PH1 and SH1 viruses demonstrated 74% nucleotide identity, allowing detailed analysis of divergent regions and detection of repeat-mediated deletions . Similar approaches could reveal key functional domains within ORF13.
Post-translational modifications (PTMs) often regulate viral protein function. Researchers investigating ORF13 PTMs should consider:
Mass spectrometry-based approaches:
Enrichment strategies for specific modifications
Top-down proteomics for intact protein analysis
Multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage
Site-directed mutagenesis of putative modification sites
In vitro modification assays with host enzymes
Research on other viral proteins has demonstrated that PTMs can significantly impact viral assembly, host interactions, and immune evasion. When studying archaeal viral proteins specifically, researchers should consider the unique PTM systems present in archaeal hosts, which may differ from bacterial and eukaryotic systems.