Recombinant His1 virus Uncharacterized protein ORF20 (ORF20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
ORF20; Uncharacterized protein ORF20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)
Target Names
ORF20
Target Protein Sequence
MVSSKWNMITELFLGAANSYAQMRGKITHYEIQHDGTIQHEFIDPSNTEEKAWDLEDNPE QQISVKGYANSCTLTVKDDSNEVELVPSGRYKQYMENQILSQTMQTGSMDSQKMMYLSIA NLATLLLFGIIGLSIIT
Uniprot No.

Target Background

Database Links

KEGG: vg:5142388

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is His1 virus Uncharacterized protein ORF20?

His1 virus Uncharacterized protein ORF20 is a 137-amino acid protein encoded by Haloarcula hispanica virus 1 (His1V), an archaeal virus that infects halophilic archaea. The protein is currently classified as uncharacterized, with limited information regarding its structural characteristics and function in viral replication. The recombinant form is typically produced with an N-terminal His-tag to facilitate purification and downstream applications .

The amino acid sequence of the protein is: MVSSKWNMITELFLGAANSYAQMRGKITHYEIQHDGTIQHEFIDPSNTEEKAWDLEDNPEQQISVKGYANSCTLTVKDDSNEVELVPSGRYKQYMENQILSQTMQTGSMDSQKMMYLSIANLATLLLFGIIGLSIIT . Bioinformatic analysis suggests the C-terminal region contains hydrophobic residues that may indicate a membrane-associated domain.

How is recombinant His1 virus ORF20 protein typically expressed and purified?

Recombinant His1 virus ORF20 protein is primarily expressed using E. coli expression systems . The methodology typically involves:

  • Cloning the ORF20 gene (1-137aa) into an expression vector with an N-terminal His-tag

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Cell lysis using mechanical or chemical methods

  • Purification via immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Further purification steps may include size exclusion chromatography or ion-exchange chromatography

  • Final processing into a lyophilized powder for long-term storage

The expressed protein appears to maintain its structural integrity through this process, with purity levels typically exceeding 90% as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant His1 virus ORF20 protein?

Based on experimental data, the following storage conditions are recommended for maintaining protein stability and functionality:

Storage TypeTemperatureAdditivesDurationNotes
Lyophilized form-20°C/-80°COriginal bufferLong-termRecommended for shipping and extended storage
Working solution4°CTris/PBS-based bufferUp to one weekAvoid repeated freeze-thaw cycles
Long-term solution-20°C/-80°C5-50% glycerol (50% recommended)MonthsAliquoting is necessary for multiple use

Prior to opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For functional studies, buffer composition may need to be optimized based on the specific application.

How can I determine the potential function of His1 virus ORF20 protein?

Elucidating the function of uncharacterized viral proteins requires a multi-faceted approach:

  • Comparative Sequence Analysis:

    • Perform BLAST and HHpred searches against protein databases

    • Look for conserved domains and motifs using tools like InterProScan

    • Generate multiple sequence alignments with homologs from related viruses

  • Structural Analysis:

    • Submit sequences to structure prediction servers (AlphaFold2, I-TASSER)

    • Analyze predicted structures for functional clues

    • Compare with known structures in the PDB database

  • Interaction Studies:

    • Conduct pull-down assays using His-tagged ORF20

    • Perform co-immunoprecipitation experiments from infected cells

    • Use yeast two-hybrid or proximity-based labeling methods

  • Functional Assays:

    • Test for enzymatic activities based on structural predictions

    • Analyze effects of expression on host cells

    • Examine localization during viral infection

While specific function of His1 virus ORF20 remains undetermined, researchers working with homologous proteins in other viral systems have found that similar ORF proteins can play roles in viral replication and modulation of host responses .

How does the His1 virus ORF20 compare to other viral ORF20 proteins?

While His1 virus ORF20 remains largely uncharacterized, interesting parallels can be drawn with the better-studied ORF20 protein from the Kaposi's sarcoma-associated herpesvirus (KSHV):

FeatureHis1 virus ORF20KSHV ORF20
Size137 amino acids Multiple isoforms (full length, intermediate, short)
Conserved domainsUncharacterizedMember of herpesvirus UL24 family with five conserved homology domains
Enzymatic activityUnknownContains PD-(D/E)XK putative endonuclease motif
FunctionUnknownPromotes coordinated lytic reactivation for viral production
Expression systemE. coli Various systems including iSLK cells

Despite differences in host range and viral classification, studying functional mechanisms of better-characterized viral ORF proteins can guide experimental approaches for His1 virus ORF20. The KSHV ORF20 protein has been shown to play critical roles in viral replication cycles and contains an endonuclease motif that contributes to its function .

What experimental approaches can be used to study the role of ORF20 in viral replication?

To investigate the role of His1 virus ORF20 in viral replication, researchers can employ the following methodologies:

  • Genetic Modification Approaches:

    • Generate recombinant viruses with ORF20 deletions or mutations

    • Assess effects on viral genome replication, transcription, and virion production

    • Develop complementation assays with wild-type and mutant versions

  • Structural Biology Techniques:

    • Determine 3D structure through X-ray crystallography, NMR, or cryo-EM

    • Analyze structure-function relationships through guided mutagenesis

    • Identify potential binding sites for protein-protein or protein-nucleic acid interactions

  • Functional Expression Studies:

    • Express ORF20 in archaeal host cells to assess effects on cellular processes

    • Monitor localization during infection using fluorescently tagged versions

    • Analyze temporal expression patterns during viral infection cycle

  • Host-Interaction Analysis:

    • Identify host factors that interact with ORF20

    • Determine effects on host gene expression through transcriptomics/proteomics

    • Investigate immune evasion or modulation capabilities

Studies with other viral ORF proteins have revealed critical functions in viral life cycles. For example, KSHV ORF20 influences the transcription of viral mRNAs, accumulation of viral proteins, and viral DNA replication, ultimately affecting viral yield during reactivation .

How can I design effective mutagenesis studies to identify functional domains within His1 virus ORF20?

A systematic mutagenesis approach can help identify functional regions within the uncharacterized ORF20 protein:

  • Bioinformatics-Guided Targeting:

    • Identify conserved residues through multiple sequence alignment

    • Predict functional motifs and domains using tools like PROSITE and Pfam

    • Use structural predictions to identify surface-exposed residues likely involved in interactions

  • Systematic Mutagenesis Strategies:

    • Perform alanine scanning mutagenesis of conserved or charged residues

    • Create targeted mutations based on predicted functional sites

    • Generate truncation series to identify minimal functional domains

    • Introduce domain swaps with homologous proteins from related viruses

  • Functional Validation:

    • Develop assays to measure specific activities predicted by sequence analysis

    • Test effects of mutations on protein-protein interactions

    • Assess impact on viral replication or host cell responses

  • Analysis Framework:

    • Create a structured database to document all mutations and their effects

    • Compare mutational impact with structural predictions

    • Use statistical methods to identify significant functional regions

For example, studies with KSHV ORF20 revealed that the putative endonuclease motif is critical for function, as mutation of this motif prevented complementation of an ORF20-null virus . Similar approaches could identify functional domains within His1 virus ORF20.

What techniques can be used to investigate potential enzymatic activities of His1 virus ORF20?

To characterize potential enzymatic functions of His1 virus ORF20:

  • Activity Prediction and Screening:

    • Use sequence analysis to predict potential enzymatic functions

    • Screen purified recombinant protein against various substrates (DNA, RNA, proteins)

    • Test under various buffer conditions, considering the halophilic nature of the virus

  • Nuclease Activity Testing:

    • Incubate with different nucleic acid substrates (ssDNA, dsDNA, RNA)

    • Analyze degradation patterns through gel electrophoresis

    • Determine sequence or structure specificity of activity

  • Optimization and Characterization:

    • Test activity across range of salt concentrations, pH, and temperatures

    • Identify cofactor requirements (metal ions, ATP, etc.)

    • Determine kinetic parameters (Km, Vmax) for confirmed activities

  • Mutation Analysis:

    • Create point mutations in predicted catalytic residues

    • Correlate loss of activity with specific residues

    • Compare with known enzymes of similar function

  • Structural Studies:

    • Obtain crystal structures with substrates or substrate analogs

    • Identify active site architecture

    • Model reaction mechanisms

This methodological framework mirrors approaches used with other viral proteins. For example, the KSHV ORF20 contains a PD-(D/E)XK putative endonuclease motif that contributes to its function in viral replication , suggesting that nuclease activity testing would be a logical starting point for His1 virus ORF20.

How can I optimize the expression and solubility of recombinant His1 virus ORF20 for structural studies?

Optimizing expression and solubility of archaeal viral proteins presents unique challenges that can be addressed through systematic optimization:

  • Expression System Optimization:

    Expression SystemAdvantagesConsiderations
    E. coliFast growth, high yield, established protocols May lack proper folding for archaeal proteins
    Archaeal hostsNative-like environment, proper foldingLower yields, more complex cultivation
    Cell-free systemsRapid screening, toxic protein toleranceHigher cost, optimization needed
  • Expression Condition Screening:

    • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

    • Vary induction temperature (16°C, 25°C, 30°C, 37°C)

    • Optimize induction parameters (IPTG concentration, induction timing)

    • Evaluate auto-induction media effectiveness

  • Construct Engineering:

    • Create truncation constructs removing hydrophobic regions

    • Test different fusion partners (MBP, GST, SUMO, Trx)

    • Optimize codon usage for expression host

    • Incorporate TEV or PreScission protease sites for tag removal

  • Solubility Enhancement:

    • Screen buffer compositions (pH, salt concentration, additives)

    • Include stabilizing agents (glycerol, arginine, trehalose)

    • Test mild detergents for hydrophobic regions

    • Co-express with molecular chaperones

  • Purification Strategy Development:

    • Optimize IMAC conditions for His-tagged protein

    • Implement orthogonal purification steps (ion exchange, size exclusion)

    • Develop condition screening for tag removal

    • Establish quality control metrics (DLS, SEC-MALS, CD)

The current protocol involving expression in E. coli with an N-terminal His-tag provides a starting point , but optimization would likely be required for high-resolution structural studies.

How can tagged versions of His1 virus ORF20 be used to study viral replication mechanisms?

Creating tagged versions of ORF20 can provide valuable tools for understanding its role in viral replication:

  • Epitope Tag Applications:

    • Use HA, FLAG, or Myc tags for sensitive detection by immunofluorescence

    • Apply chromatin immunoprecipitation (ChIP) to identify potential DNA binding sites

    • Perform co-immunoprecipitation to identify interaction partners

  • Fluorescent Protein Fusions:

    • Generate GFP or mCherry fusions to track localization in live cells

    • Monitor dynamics during infection using time-lapse microscopy

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

  • Enzymatic Reporter Fusions:

    • Create luciferase fusions for quantitative measurement of expression

    • Use split-reporter systems to detect protein-protein interactions

    • Develop biosensors for monitoring protein activity

This approach has been successfully applied to study other viral proteins. For example, researchers developed tagged HEV genomes with functional reporter insertions in the ORF1 protein, allowing visualization of the viral replication complex and monitoring of viral replication .

What can be learned from comparing His1 virus ORF20 with ORF20 proteins from other viral families?

Comparative analysis across viral families can reveal evolutionary and functional insights:

  • Evolutionary Relationships:

    • Construct phylogenetic trees of ORF20-like proteins across viral families

    • Identify conserved residues that may indicate functional importance

    • Analyze selective pressure on different protein regions

  • Functional Conservation:

    • Compare known functions of ORF20 homologs in different viruses

    • Identify common interaction partners or cellular targets

    • Test functional complementation across viral families

  • Structural Comparison:

    • Compare predicted or determined structures of ORF20 proteins

    • Identify conserved structural features despite sequence divergence

    • Analyze binding sites and catalytic centers

Research with KSHV ORF20 has shown it belongs to the conserved herpesvirus UL24 protein family with five conserved homology domains and plays a role in promoting coordinated lytic reactivation . Such information provides a framework for investigating potential conserved functions in His1 virus ORF20, despite the evolutionary distance between these viral families.

What challenges might researchers encounter when using recombinant His1 virus ORF20 in experimental systems?

Working with archaeal viral proteins presents several methodological challenges:

  • Expression and Purification Challenges:

    • Protein folding may be affected by the absence of archaeal-specific chaperones

    • Halophilic proteins often require high salt concentrations for stability

    • Traditional purification buffers may not provide optimal conditions

  • Functional Assay Development:

    • Limited knowledge of natural function complicates assay design

    • Archaeal proteins may require specific conditions (high salt, high temperature)

    • Finding appropriate positive controls can be difficult

  • Structural Analysis Limitations:

    • Hydrophobic regions (as seen in C-terminus) may cause aggregation

    • Crystallization conditions may differ from standard protocols

    • Protein dynamics may be difficult to capture

  • Biological Relevance Assessment:

    • Connecting in vitro findings to in vivo function requires archaeal host systems

    • Limited tools available for genetic manipulation of archaeal viruses

    • Establishing physiological relevance of biochemical findings

These challenges necessitate careful experimental design and validation. Systematic optimization of expression conditions and buffer compositions, combined with appropriate controls, can help overcome these obstacles to generate reliable research findings.

What are the next frontiers in understanding His1 virus ORF20 function?

The advancement of research on His1 virus ORF20 will likely proceed along several complementary paths:

  • Structural Biology Approaches:

    • High-resolution structure determination using cryo-EM or X-ray crystallography

    • Molecular dynamics simulations to understand protein flexibility

    • Structure-guided functional hypothesis generation

  • Systems Biology Integration:

    • Viral-host protein interaction networks

    • Temporal analysis of protein function during infection cycle

    • Multi-omics approaches to understand broader impacts

  • Comparative Virology:

    • Cross-species functional analysis of ORF20-like proteins

    • Evolutionary analysis to trace functional adaptations

    • Host-range determinants and their relationship to ORF20 function

  • Technological Innovations:

    • Development of archaeal genetic systems for in vivo studies

    • Application of advanced imaging techniques to archaeal virus-host systems

    • High-throughput screening approaches for function discovery

The potential relationship between His1 virus ORF20 and other viral proteins with endonuclease motifs, such as KSHV ORF20 , suggests that nucleic acid metabolism may be a promising area for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.