Recombinant Histidine-rich membrane protein KE4 homolog 1 (hke-4.1)

Shipped with Ice Packs
In Stock

Description

Functional Insights

hke-4.1 is implicated in intracellular zinc homeostasis, distinct from plasma membrane-localized ZIP transporters like LIV-1 . Experimental studies demonstrate its ability to elevate intracellular free zinc levels in a time- and concentration-dependent manner, as measured using zinc-specific fluorescent dyes .

Key Functional Attributes:

  • Subcellular Localization: Predominantly localized to intracellular membranes, including the endoplasmic reticulum .

  • Zinc Transport Mechanism: Modulates zinc flux across intracellular compartments, influencing cellular processes such as apoptosis and signal transduction .

  • Pathway Associations: Linked to zinc metabolism pathways, though specific interactors remain under investigation .

Research Applications

This recombinant protein is utilized in diverse experimental contexts:

ApplicationDescription
Zinc Homeostasis StudiesInvestigating intracellular zinc dynamics and dysregulation in disease models .
Structural BiologyAnalyzing transmembrane domain architecture via X-ray crystallography or NMR .
ImmunoassaysServing as an antigen in ELISAs for antibody validation .
C. elegans ResearchFunctional genomics to explore metal transporter roles in nematode biology .

Research Implications

Aberrant zinc regulation by proteins like hke-4.1 is associated with pathologies such as cancer, neurodegeneration, and immune dysfunction . Its recombinant form enables mechanistic studies of zinc's role in:

  • Mitochondrial Function: Zinc overload linked to superoxide production and oxidative stress .

  • Cell Proliferation: Zinc's dual role as a growth promoter and apoptosis inducer .

  • Therapeutic Development: Targeting zinc transporters for disease modulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
zipt-7.1; hke-4.1; CBG00379; Zinc transporter zipt-7.1; Histidine-rich membrane protein KE4 homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
hke-4.1
Target Protein Sequence
MRLLTVVLLLPLLIICHEHSHHHHDDEGSAVLTKVGLDDHELHEHDHDHDHDHKILRWDE KKNHSSHEKVPHSQLSTLKVWVFSLSAVIGISLAPCTLLFFIPAQHANGPFLKILLAFGA GGLLGDALLHIIPHSLNPHSHGAHDHDHAHSHDHAHNDHSHDHSDQLRVGIYVIAGILVF MMVEQLVRIIKGGHCHSHENGHIVADEHRHLNDDHHHHHNGEKKQEVEGLKDIKASAYLN LVADFVHNMTDGLAIGASFSAGSTLGWVTTLTVLLHELPHEVGDFAILVQSGFSKYQAIR MQAVTALGAITGCIFSLLISNPVLSAEGDTGAIMPFTAGGFIYIATVSVIPELLESGDHN NMSKVAKMAQSLVHLIAICMGVGMMYIVSLVE
Uniprot No.

Target Background

Function
This zinc transporter regulates intracellular zinc levels. It plays a critical role in spermatogenesis in both hermaphrodites and males. In immature sperm and spermatids, it exists in an inactive state. However, it is likely activated in response to reduced spe-4 and spe-6 function. Upon activation, it mediates the release of zinc from internal stores in spermatids into the cytoplasm. The resulting increase in cytoplasmic zinc levels promotes spermatid activation and subsequent differentiation into mature motile sperm capable of fertilization.
Database Links

STRING: 6238.CBG00379

Protein Families
ZIP transporter (TC 2.A.5) family, KE4/Catsup subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural classification and functional role of HKE4 protein?

HKE4 belongs to the subfamily of ZIP (Zrt-, Irt-like Proteins) zinc transporters, specifically within the LIV-1 subfamily of ZIP zinc Transporters (LZT). The HKE4 protein contains similarities to other ZIP transporters, including the consensus sequence in transmembrane domain IV, which is essential for zinc transport. What distinguishes the LZT subfamily from other ZIP transporters is the presence of a highly conserved potential metalloprotease motif (HEXPHEXGD) in transmembrane domain V . Functionally, HKE4 has been characterized for its ability to increase intracellular free zinc in a time-, temperature- and concentration-dependent manner. Unlike other LZT proteins such as LIV-1 that function at the plasma membrane, HKE4 is primarily located on intracellular membranes, including the endoplasmic reticulum .

How do I effectively express recombinant HKE4 protein in mammalian cells?

For successful expression of recombinant HKE4 in mammalian cells, utilize an appropriate expression vector containing the gene of interest (GOI) for HKE4. The most effective host system for HKE4 expression is human cell lines such as HEK-293T cells, which provide proper post-translational modifications and cellular localization . The transfection protocol should be optimized for intracellular membrane proteins, using either calcium phosphate precipitation, lipofection, or electroporation methods.

For optimal expression:

  • Clone the full HKE4 coding sequence into a mammalian expression vector with a strong promoter (CMV promoter is commonly used)

  • Include appropriate tags (His-tag or fluorescent protein tags) for detection and purification

  • Transfect cells at 70-80% confluence for maximum efficiency

  • Conduct expression analysis 24-72 hours post-transfection

  • Verify protein expression through Western blotting and cellular localization through immunofluorescence microscopy

What experimental design is most appropriate for studying HKE4 zinc transport activity?

A factorial design approach is most appropriate when studying HKE4 zinc transport activity, as it allows for the evaluation of multiple factors and their interactions simultaneously .

FactorLow LevelHigh Level
Temperature25°C37°C
Zinc concentration1 μM10 μM
Time intervals5 min30 min
pH6.57.4

Table 1: Factorial design parameters for HKE4 zinc transport activity assessment

To measure intracellular zinc accumulation mediated by HKE4, employ the zinc-specific fluorescent dye Newport Green, which allows for time-course measurements of zinc influx under various experimental conditions . The factorial design should include appropriate controls such as untransfected cells and cells expressing known zinc transporters (e.g., LIV-1). Statistical analysis should employ ANOVA to determine the significance of each factor and their interactions in affecting zinc transport activity .

How should I establish appropriate controls when characterizing the subcellular localization of HKE4?

Establishing appropriate controls for subcellular localization studies of HKE4 requires a comprehensive approach that includes both positive and negative controls. Since HKE4 has been identified on intracellular membranes, particularly the endoplasmic reticulum (ER) , your experimental design should include:

  • Positive controls: Co-localization studies with established ER markers (e.g., calnexin, PDI, or Sec61β)

  • Negative controls: Plasma membrane markers (e.g., Na⁺/K⁺-ATPase) and other organelle markers (e.g., TGN46 for Golgi apparatus)

  • Empty vector controls: Cells transfected with the expression vector lacking the HKE4 insert

  • Related protein controls: Other LZT family members with known localizations (e.g., LIV-1 for plasma membrane comparison)

Immunofluorescence microscopy should be performed with specific antibodies against HKE4 and organelle markers, followed by quantitative co-localization analysis using Pearson's correlation coefficient or Mander's overlap coefficient to determine the degree of co-localization .

How should I approach contradictory findings regarding HKE4 function in my research?

When facing data that contradicts either your hypothesis or previously published results about HKE4 function, a systematic approach is essential . First, thoroughly examine your data to identify specific discrepancies. Compare your experimental conditions with those reported in the literature, particularly focusing on cell types, expression levels, and measurement techniques used to assess zinc transport activity .

Consider these methodological aspects when resolving contradictions:

  • Evaluate your initial assumptions about HKE4 localization and function

  • Assess potential technical issues in your experimental setup

  • Consider alternative explanations for the contradictory data

  • Modify data collection processes if necessary

  • Refine variables and implement additional controls

For example, if your data shows different subcellular localization or zinc transport kinetics compared to published reports, investigate whether these differences might be due to:

  • Cell type-specific effects

  • Different splice variants of HKE4

  • Post-translational modifications

  • Interaction with other cellular components

  • Technical limitations in zinc measurement methodologies

What statistical approaches are most appropriate for analyzing HKE4 zinc transport activity data?

When analyzing HKE4 zinc transport activity data, the statistical approach should be tailored to the experimental design and data characteristics. For time-course experiments measuring zinc influx with Newport Green fluorescence , consider the following statistical methods:

  • Repeated measures ANOVA: For analyzing time-dependent changes in zinc levels across different experimental conditions

  • Multiple regression analysis: To assess the relationship between zinc transport activity and various predictors (temperature, zinc concentration, pH)

  • Non-linear regression models: For fitting zinc uptake kinetics to determine transport parameters (Vmax, Km)

When comparing HKE4 transport activity with other zinc transporters or mutant variants, employ:

  • Two-way ANOVA: To assess main effects and interactions between transporter type and experimental conditions

  • Post-hoc tests (e.g., Tukey's HSD or Bonferroni correction): For multiple pairwise comparisons

  • Effect size calculation: To quantify the magnitude of differences between experimental groups

Ensure appropriate data transformation (e.g., log transformation) if the data violates assumptions of normality or homogeneity of variance.

What strategies can be employed to investigate the proposed metalloprotease motif (HEXPHEXGD) in HKE4?

The highly conserved potential metalloprotease motif (HEXPHEXGD) in transmembrane domain V of HKE4 represents a distinguishing feature of the LZT subfamily . To investigate its functional significance, employ the following structure-function analysis strategies:

  • Site-directed mutagenesis: Generate point mutations in the key residues of the HEXPHEXGD motif, particularly the histidine and glutamic acid residues potentially involved in metal coordination

  • Domain swapping: Exchange the transmembrane domain V containing the motif with corresponding domains from non-LZT zinc transporters

  • Metalloprotease activity assays: Test whether HKE4 exhibits proteolytic activity using fluorogenic peptide substrates

  • Metal binding studies: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to assess binding of different metal ions to the wild-type and mutant HKE4 proteins

  • Structural analysis: Use cryo-EM or X-ray crystallography approaches to resolve the structure of the transmembrane domain containing the motif

MutationExpected Effect on Zinc TransportExpected Effect on Potential Proteolytic Activity
H→A in HEXPHEXGDReduced zinc transportLoss of metal coordination
E→Q in HEXPHEXGDPartial retention of functionReduced catalytic activity
D→N in HEXPHEXGDAltered metal selectivityAltered substrate specificity

Table 2: Predicted functional consequences of mutations in the HEXPHEXGD motif of HKE4

How can I design experiments to elucidate the physiological role of HKE4 in zinc homeostasis at the cellular level?

To elucidate the physiological role of HKE4 in cellular zinc homeostasis, a multifaceted experimental approach is required that combines genetic manipulation, real-time imaging, and physiological assays:

  • CRISPR/Cas9-mediated knockout: Generate HKE4-deficient cell lines to assess the consequences of HKE4 loss on total cellular zinc content, organelle-specific zinc levels, and cell growth under various zinc conditions

  • Inducible expression systems: Develop cell lines with tetracycline-inducible HKE4 expression to study dose-dependent and temporal effects of HKE4 on zinc distribution

  • Zinc-sensitive fluorescent protein sensors: Express organelle-targeted zinc sensors (e.g., ER-ZapCY1) to monitor zinc levels in specific subcellular compartments in real-time following manipulation of HKE4 expression or activity

  • Interactome analysis: Perform proximity labeling (BioID or APEX) combined with mass spectrometry to identify proteins that physically interact with HKE4, providing insights into its functional network

  • Functional readouts: Assess the consequences of HKE4 modulation on zinc-dependent cellular processes, including protein folding in the ER, activity of zinc-dependent enzymes, and cellular responses to zinc deficiency or excess

These approaches should be implemented in physiologically relevant cell types where zinc homeostasis plays critical roles, such as immune cells, neurons, or specialized secretory cells .

What are the most effective methods for studying the interplay between HKE4 and other zinc transporters in controlling intracellular zinc distribution?

The coordination between different zinc transporters, including HKE4, is crucial for maintaining proper zinc homeostasis across cellular compartments. To study these interactions effectively:

  • Co-expression studies: Systematically co-express HKE4 with other zinc transporters (ZIP and ZnT family members) and measure changes in zinc distribution using compartment-specific zinc sensors

  • Conditional knockdown/knockout approaches: Utilize inducible shRNA or CRISPR interference systems to deplete multiple zinc transporters in defined temporal sequences

  • Live-cell imaging: Employ dual-color labeling of HKE4 and other transporters combined with zinc sensors to visualize their dynamic relationships during zinc flux

  • Zinc chelation and supplementation: Challenge cells with zinc chelators (TPEN) or zinc supplementation while monitoring the compensatory responses of HKE4 and other transporters

  • Transcriptional profiling: Use RNA-seq analysis to identify coordinated changes in expression of zinc transporters following manipulation of HKE4 levels or activity

TransporterSubcellular LocalizationExpected Functional Relationship with HKE4
ZIP7ER membranePotential functional redundancy
ZIP9Golgi/ERComplementary role in intracellular zinc distribution
ZnT5Golgi/secretory vesiclesOpposing function in zinc transport direction
ZnT7GolgiSequential action in zinc trafficking pathway

Table 3: Potential functional relationships between HKE4 and other intracellular zinc transporters

What are the emerging research areas and methodological approaches for studying HKE4 in relation to disease states?

Given the importance of zinc homeostasis in cellular function, HKE4's role in disease states represents a significant area for future investigation. Emerging research areas include:

  • Neurodegenerative diseases: Investigating HKE4's contribution to zinc dyshomeostasis in conditions like Alzheimer's disease or amyotrophic lateral sclerosis

  • Cancer biology: Examining altered HKE4 expression or function in various cancer types, particularly in relation to altered zinc metabolism in tumor cells

  • Immunological disorders: Studying HKE4's role in immune cell function, as zinc is critical for immune responses

  • Single-cell analysis: Utilizing single-cell transcriptomics and proteomics to understand cell-type specific roles of HKE4

  • In vivo models: Developing tissue-specific conditional knockout models for HKE4 to study its physiological roles in intact organisms

Advanced methodological approaches should include:

  • CRISPR-based screenings to identify genetic interactions with HKE4

  • Quantitative high-content imaging to assess zinc distribution at subcellular resolution

  • Structural biology approaches (cryo-EM) to determine HKE4's three-dimensional structure

  • Systems biology approaches to model zinc flux through intracellular compartments

How should researchers approach the systematic review of literature on HKE4 and related zinc transporters?

Conducting a systematic review of HKE4 and related zinc transporters requires a rigorous methodological approach. Based on established systematic review practices, researchers should:

  • Define clear review scope and eligibility criteria: Specify inclusion/exclusion criteria based on study design, model systems, and outcomes measured

  • Develop comprehensive search strategy: Use multiple databases (MEDLINE, Embase, Web of Science) with carefully designed search terms covering all relevant nomenclature (HKE4, SLC39A family, ZIP transporters, etc.)

  • Implement robust study selection process: Use two independent reviewers for screening, with a third to resolve disagreements

  • Extract data systematically: Develop standardized forms capturing methodological details, experimental conditions, and key findings

  • Assess risk of bias: Evaluate methodological quality of included studies using appropriate tools

  • Synthesize evidence appropriately: Consider heterogeneity of studies when deciding between narrative synthesis or meta-analysis approaches

When evaluating experimental approaches in HKE4 research, pay special attention to:

  • Cell types used (relevance to physiological context)

  • Methods for measuring zinc transport (direct vs. indirect)

  • Controls employed (specificity of effects)

  • Verification of subcellular localization

  • Consideration of potential confounding factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.