Recombinant Histidine transport system permease protein hisM (hisM)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

HisM is a permease component of the histidine-specific ABC transporter complex, which includes:

  • HisQ: Membrane-spanning subunit.

  • HisP: ATP-binding subunit (two copies).

  • HisJ: Periplasmic histidine-binding protein.

The recombinant form of HisM is produced in Escherichia coli with an N-terminal His tag for purification . Its primary function is to form a transmembrane channel that translocates histidine into the cytoplasm upon ATP hydrolysis by HisP .

Functional Mechanisms

The HisQM-P2_2 complex operates through a tightly regulated cycle:

  1. Signal Induction: Histidine binding to HisJ triggers conformational changes transmitted to HisQM .

  2. ATP Hydrolysis: HisP hydrolyzes ATP, with activity modulated by HisQM (intrinsic rate: 0.5 s1^{-1}; HisJ-induced rate: 8 s1^{-1}) .

  3. Transport: HisQM mediates substrate translocation, while HisP dimerization—enforced by HisQM—enhances ATPase activity 3-fold compared to soluble HisP .

Notably, HisQM suppresses basal ATPase activity to prevent futile hydrolysis but stimulates it upon HisJ activation .

Research Applications

Recombinant HisM is critical for:

  • ABC Transporter Studies: Investigating substrate translocation mechanisms and ATPase regulation .

  • Membrane Protein Interactions: Mapping subunit interfaces via cross-linking or co-immunoprecipitation .

  • Drug Discovery: Screening inhibitors targeting bacterial amino acid transporters .

Commercial variants (e.g., Creative BioMart, MyBioSource) are available for in vitro assays .

Key Experimental Findings

  • Reconstitution Studies: HisP can be stripped from HisQM and reassembled into a functional complex in vitro, confirming non-covalent subunit interactions .

  • Regulatory Role: HisQM increases HisP’s ATPase activity 60-fold in the presence of HisJ .

  • Evolutionary Conservation: HisM homologs in Firmicutes retain conserved regulatory motifs (e.g., HisR-binding sites) .

Future Directions

Ongoing research aims to:

  • Resolve high-resolution structures of the HisQM-P2_2 complex.

  • Engineer hyperactive mutants for industrial histidine production.

  • Explore cross-species functional compatibility among ABC transporters .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that specified tag.
Synonyms
hisM; STY2582; t0512; Histidine transport system permease protein HisM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Salmonella typhi
Target Names
hisM
Target Protein Sequence
MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIW LFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEI FAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTA TVPDLLKIARDINSATYQPFTAFGIAAVLYLLISYVLISLFRRAERRWLQHVSSK
Uniprot No.

Target Background

Function
Histidine transport system permease protein HisM (HisM) is a component of the histidine permease ABC transporter and a part of a lysine/arginine/ornithine transporter. It is likely responsible for the translocation of the substrate across the membrane. HisM is essential for relaying the ATPase-inducing signal from the solute-binding protein to HisP.
Database Links

KEGG: stt:t0512

STRING: 220341.STY2582

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Histidine transport system permease protein HisM?

HisM is an integral membrane protein that forms part of the periplasmic histidine transport system in bacteria such as Salmonella typhimurium. It functions as a component of a membrane-bound complex that facilitates the transport of histidine across the bacterial membrane. The protein works in conjunction with other components (HisQ and HisP) to form a functional transport channel, with HisM and HisQ creating the transmembrane portions through which histidine molecules pass .

How does HisM interact with other components of the histidine transport system?

HisM forms a complex with HisQ (another integral membrane protein) and HisP (a hydrophilic protein with unusual membrane association properties). Experimental evidence from coimmunoprecipitation studies demonstrates that these three proteins associate tightly. Chemical cross-linking analysis has revealed a specific stoichiometry of the complex: two HisP subunits to one HisQ and one HisM subunit. Within this complex, all three proteins likely contact each other directly, with HisQ and HisM forming a membrane-spanning channel that houses the HisP subunits .

What experimental evidence supports the membrane integration of HisM?

Experimental extraction techniques using urea, alkaline pH, and Triton X-114 have definitively shown that HisM is an integral membrane protein. These extraction methods distinguish between peripheral and integral membrane proteins based on their resistance to removal from the membrane. Unlike HisP, which displays unusual membrane association behavior, HisM consistently behaves as a typical integral membrane protein in these assays, indicating multiple membrane-spanning segments incorporated into the lipid bilayer .

What expression systems are most effective for producing recombinant HisM?

For membrane proteins like HisM, bacterial expression systems (particularly E. coli) are commonly employed due to their high yield and relatively straightforward protocols. The recombinant construct typically includes a C-terminal 6-His tag to facilitate purification, similar to other recombinant membrane proteins . Expression optimization requires careful consideration of induction conditions, including temperature (often lowered to 18-25°C), inducer concentration, and expression duration to prevent formation of inclusion bodies that can occur with overexpression of membrane proteins.

How can between-subjects experimental designs be applied to HisM functional studies?

In between-subjects experimental designs for HisM studies, different experimental groups would be exposed to distinct conditions, with each subject experiencing only one condition. For example, when investigating HisM mutations, different groups of bacterial cultures could express different HisM variants, with one group serving as a control expressing wild-type HisM. This approach minimizes carryover effects but requires careful matching of experimental groups to ensure comparable baseline characteristics .

What methods can confirm the proper folding and membrane insertion of recombinant HisM?

Proper folding and membrane insertion of recombinant HisM can be assessed through multiple complementary approaches:

  • Circular dichroism spectroscopy to analyze secondary structure

  • Limited proteolysis assays to detect exposed protein regions

  • Functional transport assays using radioactively labeled histidine

  • Fluorescence-based membrane localization studies

  • Detergent solubilization profiles compared to known membrane proteins

These methods collectively provide evidence that the recombinant protein has achieved its native conformation within the membrane environment.

How can the stoichiometry of the HisQMP complex be determined with precision?

The stoichiometry of the HisQMP complex can be determined through a combination of techniques:

  • Chemical cross-linking with bifunctional reagents that create covalent bonds between neighboring proteins, followed by analysis of the resulting complexes by SDS-PAGE

  • Mass spectrometry of intact complexes maintained in detergent micelles

  • Size-exclusion chromatography combined with multi-angle light scattering

  • Analytical ultracentrifugation to measure the molecular weight of the complex

These approaches have established that the complex consists of two HisP subunits to one HisQ and one HisM subunit . The precision of these measurements depends on sample purity and the resolution of the analytical technique employed.

What are the challenges in studying conformational changes in HisM during the transport cycle?

Studying conformational changes in HisM presents several methodological challenges:

  • The dynamic nature of transport processes makes capturing intermediate states difficult

  • The hydrophobic environment of the membrane interferes with many biophysical techniques

  • The protein must be maintained in a native-like lipid or detergent environment

  • Conformational changes may be subtle and transient

Researchers address these challenges through techniques such as:

  • Site-directed spin labeling combined with electron paramagnetic resonance

  • Single-molecule FRET to detect distance changes between labeled residues

  • Time-resolved structural methods such as stopped-flow experiments

  • Cryo-electron microscopy of the complex trapped in different conformational states

How do mutations in HisM affect complex assembly and function?

Mutations in HisM can have various effects on complex assembly and function depending on their location within the protein structure. Mutations in transmembrane domains often disrupt proper membrane insertion or alter the channel architecture, while mutations at protein-protein interfaces can prevent proper association with HisQ or HisP. Functional mutations may specifically affect histidine binding, transport kinetics, or energy coupling.

Experimental approaches to study these effects include:

  • Site-directed mutagenesis followed by expression and functional assays

  • Binding studies comparing wild-type and mutant proteins

  • Transport assays using isotope-labeled histidine

  • Coimmunoprecipitation to assess complex formation efficiency

What purification strategy yields the highest purity recombinant HisM protein?

A multi-step purification strategy is typically required to obtain high-purity recombinant HisM:

  • Membrane isolation by differential centrifugation

  • Solubilization using appropriate detergents (e.g., DDM, LMNG)

  • Immobilized metal affinity chromatography utilizing the His-tag

  • Size-exclusion chromatography to remove aggregates and misfolded protein

  • Optional ion-exchange chromatography as a polishing step

The purified protein is typically maintained in a solution containing detergent above its critical micelle concentration to prevent aggregation, similar to the approaches used for other membrane proteins .

How can researchers assess the stability of purified recombinant HisM?

The stability of purified recombinant HisM can be assessed through:

  • Thermal stability assays using differential scanning fluorimetry

  • Long-term storage tests at different temperatures with regular activity checks

  • Monitoring protein aggregation through dynamic light scattering

  • Functional reconstitution assays in proteoliposomes over time

  • Limited proteolysis resistance compared to freshly purified protein

These methods provide complementary information about the structural and functional stability of the purified protein, which is critical for subsequent experimental applications.

What reconstitution methods are most effective for functional studies of recombinant HisM?

Effective reconstitution of HisM into artificial membranes requires careful consideration of:

  • Lipid composition (typically E. coli polar lipids or defined mixtures)

  • Protein-to-lipid ratio (optimized for specific assays)

  • Detergent removal method (dialysis, biobeads, or cyclodextrin)

  • Buffer conditions (pH, salt concentration, stabilizing additives)

The reconstituted proteoliposomes can be assessed for:

  • Protein orientation using protease protection assays

  • Membrane integrity through leakage tests

  • Transport activity using radioisotope or fluorescence-based assays

  • Complex formation with HisQ and HisP by co-reconstitution

How does the function of HisM compare across different bacterial species?

HisM proteins from different bacterial species share sequence homology but may exhibit species-specific functional characteristics. Comparative studies involve:

  • Sequence alignment and phylogenetic analysis

  • Heterologous expression of HisM from different species

  • Functional characterization using standardized assays

  • Cross-complementation experiments in knockout strains

These approaches reveal evolutionary conservation and divergence in histidine transport mechanisms across bacterial taxa.

What is the relationship between HisM and other amino acid transport systems?

  • Conserved structural motifs in transmembrane domains

  • Distinct substrate binding residues that confer specificity

  • Similar energy coupling mechanisms through ATP hydrolysis

  • Analogous complex formation with other system-specific components

Understanding these relationships provides insight into the evolution and specialization of amino acid transport systems in bacteria.

How can systems biology approaches incorporate HisM transport data?

Systems biology approaches can integrate HisM transport data through:

  • Metabolic flux analysis measuring histidine uptake rates under various conditions

  • Computational modeling of transport kinetics in the context of whole-cell metabolism

  • Integration with transcriptomic and proteomic data to understand regulatory networks

  • Synthetic biology approaches to engineer transport systems with modified properties

These approaches place HisM function in the broader context of cellular physiology and bacterial adaptation to environmental changes.

What mass spectrometry techniques are most informative for studying HisM?

Mass spectrometry techniques particularly valuable for HisM research include:

TechniqueApplicationAdvantages
Hydrogen-deuterium exchange MSConformational dynamicsDetects solvent-accessible regions and conformational changes
Cross-linking MSProtein-protein interactionsMaps interaction interfaces between HisM, HisQ and HisP
Native MSComplex stoichiometryPreserves non-covalent interactions for intact complex analysis
Targeted proteomics (MRM/PRM)QuantificationPrecise measurement of HisM expression levels
Top-down proteomicsPost-translational modificationsIdentifies modifications that might regulate activity

These techniques provide complementary structural and functional information that cannot be obtained through traditional biochemical methods alone.

How can molecular dynamics simulations inform the study of HisM function?

Molecular dynamics simulations offer unique insights into HisM function by:

  • Modeling conformational changes during the transport cycle

  • Identifying water molecules and ion pathways through the channel

  • Exploring the energetics of substrate binding and release

  • Investigating how mutations affect protein dynamics and stability

  • Simulating the behavior of the HisQMP complex in a lipid bilayer environment

These computational approaches generate testable hypotheses about transport mechanisms that can guide experimental design.

What are the most sensitive methods for measuring histidine transport mediated by recombinant HisM?

Highly sensitive methods for measuring histidine transport include:

  • Radioisotope uptake assays using ³H-labeled histidine with scintillation counting

  • Fluorescence-based assays using pH-sensitive dyes to detect proton coupling

  • Electrophysiological measurements in reconstituted systems

  • Real-time transport kinetics using stopped-flow spectrometry

  • Genetically encoded biosensors for intracellular histidine detection

Each method has specific advantages and limitations regarding temporal resolution, sensitivity, and applicability to different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.