Recombinant Histidine transport system permease protein hisQ (hisQ)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant HisQ refers to the genetically engineered form of the HisQ protein, an integral membrane component of the histidine permease complex. This system includes:

  • HisJ: A periplasmic histidine-binding protein

  • HisM: A transmembrane partner of HisQ

  • HisP: An ATP-binding subunit

The complex (HisQMP₂) enables histidine transport across the cytoplasmic membrane via ATP hydrolysis . Recombinant HisQ is typically expressed in E. coli for structural and functional studies .

Functional Role in Transport

HisQ collaborates with HisM to form a membrane "channel," while HisP hydrolyzes ATP to energize substrate translocation . Key mechanisms include:

  • Signal Relay: HisQ/HisM transmits conformational changes from HisJ (ligand-bound) to HisP, activating ATPase activity .

  • Regulation: HisQ/HisM suppresses basal ATP hydrolysis by HisP until histidine-bound HisJ induces activity .

  • Substrate Specificity: HisQ contributes to selective histidine transport (Km ≈ 10⁻⁸ M) , though it also participates in arginine/lysine uptake in certain contexts .

A. Complex Assembly and Disassembly

  • HisQ/HisM retains membrane integrity even after urea treatment, enabling in vitro reconstitution of HisQMP₂ with soluble HisP .

  • HisP binds HisQM with high affinity (Kd ≈ 10⁻⁹ M), forming a functional dimer critical for ATP hydrolysis .

B. Mutational Studies

  • HisQ deletions abolish histidine transport, confirming its indispensability .

  • Cross-linking experiments reveal direct interactions between HisQ, HisM, and HisP, stabilizing the channel structure .

C. ATPase Activity Modulation

ConditionATPase Turnover Rate (s⁻¹)
HisP alone2.0
HisQMP₂ (uninduced)0.5
HisQMP₂ + HisJ-histidine8.0

Data source:

Applications and Implications

  • ABC Transporter Studies: HisQMP₂ serves as a model for understanding eukaryotic ABC transporters like CFTR .

  • Drug Delivery: Engineering HisQ-like channels could enable targeted nutrient or drug transport .

  • Antibiotic Resistance: Insights into HisQ’s role may inform strategies against pathogens exploiting ABC transporters .

References

  1. Membrane complex evidence (PubMed, 2022)

  2. In vitro reconstitution and ATPase regulation (PMC, 1998)

  3. Genetic and functional analysis (JB, 1991)

  4. Kinetic parameters of histidine transport (PMC, 2007)

  5. Component resolution (PNAS, 1970)

  6. Recombinant expression and system role (MyBioSource, 2014)

  7. Cross-functionality in arginine transport (PMC, 2015)

  8. Parallel transport components (PMC, 1970)

  9. Structural data for HisM homolog (Creative BioMart, 2025)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your needs based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
hisQ; STY2583; t0511; Histidine transport system permease protein HisQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Salmonella typhi
Target Names
hisQ
Target Protein Sequence
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVP DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
Uniprot No.

Target Background

Function
The histidine permease ABC transporter is composed of this protein. It also contributes to a lysine/arginine/ornithine transporter. It is likely responsible for translocating the substrate across the membrane. This protein plays a crucial role in relaying the ATPase-inducing signal from the solute-binding protein to HisP.
Database Links

KEGG: stt:t0511

STRING: 220341.STY2583

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the histidine transport system permease protein HisQ?

HisQ is an integral membrane protein that forms a critical component of the histidine permease ABC transporter system. It functions as one of two transmembrane components (alongside HisM) in the permease complex. This complex is responsible for the high-affinity uptake of histidine in bacteria such as Salmonella typhimurium and Escherichia coli. HisQ is specifically involved in translocation of the substrate across the bacterial membrane and is required to relay ATPase-inducing signals from the solute-binding protein to the ATP-binding subunit HisP .

What is the composition of the complete histidine permease complex?

The complete histidine permease complex consists of four proteins arranged in a specific stoichiometry. It contains two integral membrane proteins (HisQ and HisM) and two copies of the ATP-binding subunit (HisP), forming what is designated as the HisQMP₂ complex. Additionally, the complex interacts with a soluble periplasmic histidine-binding protein called HisJ, which binds histidine with high affinity and stimulates ATP hydrolysis by the HisQMP₂ complex .

How does recombinant HisQ differ from native HisQ?

Recombinant HisQ is artificially produced through cell-free expression systems, allowing for controlled production and potential modifications. While the core structure and function remain similar to native HisQ, recombinant versions may include affinity tags for purification, modifications for stability, or specific mutations for research purposes. The recombinant form allows researchers to study the protein outside its natural context and perform controlled experiments regarding its structure-function relationships .

What expression systems are recommended for recombinant HisQ production?

For recombinant HisQ production, cell-free expression systems are particularly advantageous due to the challenges associated with membrane protein expression. These systems bypass cellular toxicity issues and offer several benefits:

Expression SystemAdvantagesLimitations
Cell-freeAvoids toxicity issues; direct incorporation into liposomes possible; rapid productionLimited post-translational modifications; potentially higher cost
E. coli-basedCost-effective; high yields possible; well-established protocolsPotential toxicity; inclusion body formation; refolding challenges
Yeast systemsBetter for eukaryotic-like modifications; good for scale-upLonger production time; complex media requirements

For functional studies requiring properly folded HisQ, cell-free systems coupled with direct reconstitution into membrane mimetics have shown the best results .

What purification strategies work best for recombinant HisQ?

Purifying recombinant HisQ presents challenges due to its transmembrane nature. The most effective approach involves:

  • Solubilization using mild detergents (e.g., DDM or LMNG)

  • Affinity chromatography (if tags are incorporated)

  • Size exclusion chromatography for complex isolation

For reconstitution studies, maintaining the HisQ-HisM interaction is crucial, and harsh solubilization conditions should be avoided. Urea at specific concentrations (3.6-7.3M) can be used to selectively dissociate HisP from the HisQM complex while preserving the integrity of the membrane components for subsequent reconstitution experiments .

How can I verify the quality and integrity of purified recombinant HisQ?

Quality assessment of purified recombinant HisQ should include multiple analytical methods:

  • SDS-PAGE for purity and appropriate molecular weight

  • Western blotting with HisQ-specific antibodies

  • Circular dichroism to confirm proper secondary structure

  • Mass spectrometry for accurate mass determination and sequence verification

  • Functional reconstitution assays to verify activity (e.g., ATP hydrolysis assays when reconstituted with HisM and HisP)

The gold standard for verification is a successful reconstitution experiment showing that the purified HisQ can reassemble with other components to form a functional complex capable of ATP hydrolysis in response to HisJ stimulation .

How do I reconstitute the HisQMP₂ complex in vitro?

Reconstituting the HisQMP₂ complex involves a stepwise approach:

  • Start with HisP-depleted membranes containing HisQ and HisM (can be prepared using 7.3M urea extraction)

  • Incubate with purified soluble HisP in appropriate buffer conditions

  • Allow sufficient time for complex reassembly (typically 20-30 minutes at 4°C)

  • Verify complex formation through ATP hydrolysis assays

The reassembled complex should display normal ATP hydrolysis properties, responding to HisJ with characteristics similar to the original complex. It's important to note that HisP has high affinity for the HisQM complex, and two HisP molecules are recruited independently of each other for each HisQM unit to form the active HisQMP₂ complex .

What assays can measure HisQ functional activity?

Since HisQ itself does not possess enzymatic activity, its function must be assessed as part of the complete transporter complex. Recommended functional assays include:

Assay TypeMeasurementAdvantages
ATP hydrolysisATPase activity of reconstituted complexQuantitative, reliable indicator of proper complex assembly
Substrate transportHistidine uptake in proteoliposomesDirect measure of complete transport function
Binding studiesInteraction between HisQM and HisPAssesses complex formation efficiency
Signal relayHisJ-induced conformational changesEvaluates signal transduction capability

The ATPase activity assay is particularly informative as it demonstrates that the HisQMP₂ complex is properly assembled and functional. The activity should be stimulated by the addition of HisJ loaded with histidine, confirming proper signal relay through the complex .

How does HisQ contribute to the regulation of ATPase activity?

HisQ, together with HisM, plays a dual regulatory role in the histidine permease complex:

  • Signal transduction: HisQ and HisM are required to relay the ATPase-inducing signal from the liganded soluble receptor (HisJ) to the ATP-binding component (HisP)

  • Activity modulation: The HisQM complex regulates HisP ATPase activity through a combination of suppression and stimulation mechanisms

What is known about the stoichiometry and assembly of HisP in the functional complex?

Research on HisP recruitment and complex formation reveals:

  • Two HisP molecules are recruited independently of each other for each HisQM unit

  • The HisQMP₁ intermediate (with only one HisP bound) has little to no ATPase activity

  • Only the HisQMP₂ form (with two HisP molecules) is fully active

  • HisP molecules can be recruited individually, not necessarily as pre-formed dimers

  • The dimeric form of HisP is the enzymatically active configuration in the complex

This recruitment process is concentration-dependent, with higher concentrations of HisP increasing the likelihood of complete HisQMP₂ complex formation. The independent binding of HisP molecules suggests a sequential assembly model rather than an all-or-none binding mechanism .

How do mutations in HisQ affect complex formation and function?

Mutations in HisQ can have various effects on complex formation and function:

Mutation TypePotential EffectsResearch Applications
Interface residuesDisrupted HisM interaction; Impaired complex stabilityMapping protein-protein interfaces
Signal relay residuesReduced response to HisJ; Altered ATPase regulationIdentifying signal transduction pathways
Transmembrane domainsCompromised membrane insertion; Protein misfoldingStudying membrane integration mechanisms
Conserved motifsLoss of specific functions; Altered substrate specificityStructure-function relationship analysis

When designing mutation studies, researchers should consider conserved regions across different bacterial species and known functional domains. Complementation experiments with properly designed mutants offer valuable insights into the mechanism of action and interaction between the integral membrane and ATP-hydrolyzing domains .

How does the histidine permease system compare to other ABC transporters?

The histidine permease system serves as an excellent model for studying ABC transporters due to several features:

  • Modular composition allowing separation and characterization of individual domains

  • Well-characterized components with established purification protocols

  • Demonstrable in vitro reassembly of functional complexes

  • Clear functional readouts (ATP hydrolysis, transport)

Comparisons with other ABC transporters reveal both conserved features and unique aspects:

  • Like other ABC transporters, the histidine permease requires ATP hydrolysis for transport

  • Both ATP-binding subunits must be intact for ATP hydrolysis, similar to the maltose permease

  • The alternating catalysis model proposed for CFTR (where two nucleotide-binding sites hydrolyze ATP alternately) may apply to the histidine permease

  • The ease of reassembly suggests that in vivo assembly need not be cotranslational

These comparisons provide valuable insights for researchers studying other members of the ABC transporter superfamily, including medically significant eukaryotic transporters like CFTR and MDR1 .

What are common challenges in working with recombinant HisQ and how can they be addressed?

Working with recombinant HisQ presents several challenges inherent to membrane protein research:

ChallengeSolution StrategyScientific Rationale
Low expression yieldsOptimize codon usage; Use specialized expression hosts; Employ cell-free systemsMembrane protein toxicity often limits yield; specialized systems reduce toxicity
Protein aggregationScreen multiple detergents; Use membrane mimetics (nanodiscs, SMALPs)Different detergents provide varying stabilization of native structure
Loss of function after purificationGentle purification conditions; Maintain protein-lipid interactionsMembrane proteins often require specific lipid environments for function
Incomplete complex formationOptimize HisP:HisQM ratios; Control buffer conditionsComplex formation is concentration-dependent and requires specific conditions
Variable ATPase activityInclude control experiments; Ensure complete HisQMP₂ assemblyPartial complexes (HisQMP₁) show minimal activity

When working with proteoliposomes containing reconstituted HisQMP₂ complex, it's crucial to verify proper protein orientation. Only correctly oriented complexes will respond to HisJ addition in ATP hydrolysis assays .

What safety considerations should be observed when working with recombinant HisQ?

When working with recombinant HisQ, researchers should adhere to established biosafety guidelines:

  • Follow NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

  • Obtain proper institutional approvals before initiating experiments (e.g., Institutional Biosafety Committee)

  • Implement appropriate biosafety containment based on risk assessment

  • Consider both the expression system and the protein itself in safety evaluations

While HisQ itself is not known to pose significant hazards, the expression systems and methods used for its production might require specific safety measures. The current NIH Guidelines (April 2024) provide comprehensive guidance on risk assessment, containment practices, and regulatory compliance for work involving recombinant proteins .

How can I optimize reconstitution conditions for functional studies?

Optimizing reconstitution conditions requires systematic testing of multiple parameters:

  • Lipid composition: Test various phospholipid mixtures to identify optimal membrane environment

  • Protein-to-lipid ratios: Typically 1:50 to 1:200 (w/w), depending on specific experimental goals

  • Reconstitution method: Detergent dialysis, direct incorporation, or fusion with preformed liposomes

  • Buffer conditions: pH, ionic strength, presence of stabilizing agents

  • Temperature and incubation time: Usually 4°C for 20-30 minutes for complex assembly

For functional studies, it's essential to verify that HisP undergoes proper conformational changes upon exposure to phospholipids. Research has shown that HisP changes conformation when exposed to phospholipids, which may be crucial for its function in the assembled complex .

What are the current limitations in our understanding of HisQ function?

Despite significant advances in understanding the histidine permease system, several knowledge gaps remain:

  • Precise structural details of the HisQM membrane components

  • Exact conformational changes during the transport cycle

  • Detailed mechanism of signal transduction from HisJ through HisQM to HisP

  • Comprehensive mapping of protein-protein interaction surfaces

  • Role of lipid environment in complex stability and function

Addressing these limitations requires interdisciplinary approaches combining structural biology, biochemistry, molecular dynamics simulations, and functional studies .

How might research on HisQ inform understanding of medically relevant ABC transporters?

Research on the bacterial histidine permease system has significant implications for understanding medically relevant eukaryotic ABC transporters:

  • The modular organization demonstrates how separate domains interact functionally

  • The reconstitution methodology provides templates for studying more complex transporters

  • The signal transduction mechanisms may have parallels in human ABC transporters

  • The ATP hydrolysis regulation model may apply to transporters involved in disease

These insights can potentially inform therapeutic approaches targeting ABC transporters implicated in conditions like cystic fibrosis (CFTR), multidrug resistance in cancer (MDR1), and various metabolic disorders .

What emerging technologies might advance HisQ research in the near future?

Several emerging technologies hold promise for advancing HisQ research:

TechnologyApplication to HisQ ResearchPotential Impact
Cryo-EMHigh-resolution structural analysis of the complete complexDetailed understanding of protein-protein interfaces and conformational states
Native mass spectrometryAnalysis of intact complexes and subcomplex stoichiometryVerification of assembly dynamics and complex integrity
Single-molecule techniquesReal-time observation of transport and ATP hydrolysis cyclesMechanistic insights into the coupling between ATP hydrolysis and transport
Computational modelingPrediction of dynamic interactions and conformational changesHypothesis generation for targeted experimental validation
Advanced reconstitution methodsControlled orientation in proteoliposomes; microfluidic approachesMore reliable functional assays and higher-throughput screening

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.