Recombinant Holin-like protein CidA 1 (cidA1)

Shipped with Ice Packs
In Stock

Description

General Information

CidA and LrgA are homologous proteins that function as a holin and anti-holin, respectively, and each contains four putative transmembrane segments (TMSs) . The CidA/LrgA holin family includes putative murine hydrolase exporters from a wide range of Gram-positive and Gram-negative bacteria, as well as archaea . Most CidA/LrgA holin family proteins range in size from 100 to 160 amino acyl residues (aa), although some are larger .

Function and Mechanism

CidA and LrgA proteins are bacterial holin/antiholin-like proteins that control cell death and lysis during biofilm development . They regulate these processes similarly to bacteriophage-induced death and lysis . It has been proposed that CidA and CidB are involved in programmed cell death, analogous to apoptosis in eukaryotes . These proteins regulate and influence biofilm formation by releasing DNA from lysed cells, which contributes to the biofilm matrix .

CidA, a 131 amino acid protein with 4 putative TMSs, is believed to be the holin that exports the autolysin CidB, while LrgA may be an anti-holin, a protein that binds and inhibits holin activity . CidA, likely in conjunction with LrgA, functions to control the timing of cell lysis and DNA release during biofilm development .

Biochemical and Molecular Characterization

Membrane fractionation and fluorescent protein fusion studies have revealed that CidA and LrgA are membrane-associated proteins . Similar to holins, CidA and LrgA oligomerize into high-molecular-mass complexes, with formation dependent on disulfide bonds formed between cysteine residues . An S. aureus mutant, in which the wild-type cidA or lrgA gene was replaced with a cysteine-to-serine mutant allele, exhibited altered cell lysis during stationary phase . Furthermore, altered cell adhesion was observed during early biofilm development, and dead cells accumulated during biofilm maturation .

Holin-like Activity

CidA and LrgA have demonstrated the ability to support bacteriophage endolysin-induced cell lysis, suggesting their holin-like functions . Cell lysis induced by CidA and LrgA is dependent on the coexpression of endolysin, which is consistent with the proposed holin-like functions of these proteins . Additionally, the CidA and LrgA proteins localize to the surface of membrane vesicles and cause leakage of small molecules, providing evidence of their hole-forming potential .

Role in Biofilm Formation

The cid and lrg operons are involved in biofilm formation by controlling cell lysis and the release of genomic DNA, which becomes a structural component of the biofilm matrix . The cidA and lrgA genes encode holin and antiholin-like proteins that regulate processes similar to bacteriophage-induced death and lysis .

Regulation of cidAB and lrgAB Operons

The cidAB and lrgAB operons in S. mutans are regulated reciprocally . The lrg operon is expressed maximally in the late exponential growth phase, while the cid operon is expressed maximally during early exponential growth, both being regulated in response to oxygen and glucose . This regulation influences biofilm formation .

Mupirocin and CidA Expression

The level of cidA expression significantly increased in response to subinhibitory concentrations of mupirocin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
cidA1; BA_3730; GBAA_3730; BAS3458; Holin-like protein CidA 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
cidA1
Target Protein Sequence
MKWWKLSGQILLLFCFAWTGEWIAKQAHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q
Uniprot No.

Target Background

Function

CidA1, a recombinant holin-like protein, enhances the activity of extracellular murein hydrolases, potentially by facilitating their export through membrane pore formation. Its function is inhibited by the antiholin-like proteins LrgAB. Under normal conditions, LrgAB likely inhibits CidA1 activity. However, cellular stress (e.g., antibiotic exposure) may trigger CidA1 oligomerization within the bacterial membrane, leading to membrane lesions that disrupt the proton motive force and compromise cell viability. These lesions are also thought to regulate subsequent cell lysis by either granting murein hydrolases access to the cell wall or modulating their activity via changes in cell wall pH resulting from membrane depolarization.

Database Links

KEGG: ban:BA_3730

STRING: 260799.BAS3458

Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CidA protein and what is its primary function in bacterial cells?

CidA is a membrane-associated protein encoded by the cidABC operon in Staphylococcus aureus and functions as a holin-like protein involved in programmed cell death (PCD). CidA shares structural similarities with bacteriophage holins, including its relatively small size, the presence of two to three putative transmembrane domains, and charge-rich N and C termini . The primary function of CidA appears to be regulation of murein hydrolase activity by forming pores in the cytoplasmic membrane, allowing the passage of small molecules and potentially larger proteins . Unlike bacteriophage-induced death and lysis, the CidA-mediated PCD pathway appears to be a regulated process that contributes to biofilm development and antibiotic tolerance in bacterial populations .

How does CidA differ from LrgA protein, and what is their relationship?

CidA and LrgA are both membrane proteins encoded by the cidABC and lrgAB operons respectively in S. aureus. While structurally similar, they appear to have opposing functions - CidA has a positive effect on murein hydrolase activity (promoting cell lysis), whereas LrgA has an inhibitory effect (preventing cell lysis), suggesting a holin-antiholin-like relationship . Both proteins oligomerize into high-molecular-mass complexes dependent on disulfide bonds formed between cysteine residues . Despite their antagonistic relationship in terms of cell death regulation, both proteins have been shown to have holin-like properties, capable of forming pores within the cytoplasmic membrane that can support endolysin-induced cell lysis in experimental systems .

What evidence supports the classification of CidA as a holin-like protein?

Multiple lines of evidence support CidA's classification as a holin-like protein:

  • Structural similarities to bacteriophage holins, including small size, presence of transmembrane domains, and charged termini

  • Ability to oligomerize into high-molecular-mass complexes dependent on disulfide bonds

  • Demonstrated support of bacteriophage endolysin-induced cell lysis in "lysis cassette" experimental systems

  • Localization to membrane surfaces and induction of leakage of small molecules from liposomes, providing direct evidence of pore-forming capability

  • Impact on murein hydrolase activity and autolysis, consistent with the function of holins in controlling access of hydrolases to peptidoglycan

These properties collectively establish CidA as a functional bacterial holin, though it operates in the context of programmed cell death rather than phage-mediated lysis .

What is the molecular structure of the CidA protein and how does it contribute to its function?

CidA is a relatively small membrane protein characterized by 2-3 putative transmembrane domains. The protein contains charge-rich N and C termini which are typical features of bacteriophage holins . The structural analysis suggests that CidA can oligomerize to form high-molecular-mass complexes, with this oligomerization dependent on disulfide bonds formed between cysteine residues .

Functional studies indicate that CidA forms pores in the cytoplasmic membrane, and this pore-forming activity is likely related to its ability to oligomerize. Interestingly, when the wild-type cidA gene was replaced with a cysteine mutant allele (disrupting oligomerization), the mutant exhibited increased cell lysis during stationary phase, suggesting that oligomerization has a negative impact on the lysis process . This indicates a complex relationship between CidA structure and its cell death function, where the oligomeric state may serve as a regulatory mechanism.

How do the pores formed by CidA differ from those formed by bacteriophage holins?

Bacteriophage holins form two distinct types of pores: large, nonspecific holes (as in λ S holin) that allow the passage of preformed endolysin, or "pinholes" (as in P1 holins) that are just large enough to cause the release of small ions and collapse of the proton motive force (PMF) .

Evidence suggests that CidA may function more like the pinhole-type holins. This is supported by the observation that the primary S. aureus murein hydrolase, Atl, possesses a signal sequence , indicating it is secreted via the Sec pathway rather than requiring direct passage through a large holin pore. CidA likely forms pores that cause membrane depolarization, triggering the activity of already-secreted murein hydrolases. In experimental systems, CidA induced leakage of carboxyfluorescein from reconstituted liposomes at a lower protein-to-lipid ratio than LrgA, suggesting it may form pores more efficiently .

What is the significance of disulfide bond-dependent oligomerization in CidA function?

Disulfide bond-dependent oligomerization appears to be a critical regulatory mechanism for CidA function. Studies have shown that CidA can form high-molecular-mass complexes dependent on disulfide bonds between cysteine residues . When investigating the function of this oligomerization, researchers generated an S. aureus mutant with a cysteine mutation in cidA (disrupting the ability to form disulfide bonds).

This mutant exhibited:

  • Increased cell lysis during stationary phase, suggesting oligomerization normally limits lysis

  • Increased biofilm adhesion in static assays

  • Greater accumulation of dead cells during biofilm maturation

These findings suggest that oligomerization serves as a regulatory switch that modulates CidA's lytic activity. The ability to form oligomers through disulfide bonds may allow bacteria to fine-tune the timing and extent of programmed cell death in response to environmental conditions, particularly during biofilm development .

What are the most effective methods for detecting and quantifying CidA protein expression?

For detecting and quantifying CidA protein expression, researchers have employed several complementary techniques:

Membrane Fractionation: This technique allows separation of membrane-associated proteins like CidA from cytoplasmic components. After cell disruption and ultracentrifugation, membrane fractions can be collected and analyzed for CidA presence .

Western Blot Analysis: Using antibodies against CidA or epitope tags (such as FLAG or His) fused to recombinant CidA, Western blotting provides specific detection and semi-quantitative analysis of CidA expression. This approach has been successfully used to detect CidA in membrane fractions and to monitor its accumulation over time .

Fluorescent Protein Fusions: Genetic fusion of fluorescent proteins (GFP, mCherry, etc.) to CidA allows visualization of protein localization and expression levels in living cells. This approach has been used to confirm the membrane association of CidA .

RT-qPCR: For quantifying cidA gene expression at the transcriptional level, RT-qPCR provides a sensitive method to measure mRNA levels, which can serve as a proxy for potential protein expression .

For optimal results, combining protein-level detection methods (Western blotting, fluorescent microscopy) with transcriptional analysis (RT-qPCR) provides the most comprehensive assessment of CidA expression.

How can researchers effectively produce and purify recombinant CidA protein for in vitro studies?

Production and purification of recombinant CidA presents challenges due to its membrane-associated nature, but several approaches have proven successful:

Expression System Selection:

  • E. coli expression systems using vectors with inducible promoters (e.g., pS105 derivatives) have been successfully employed

  • Including affinity tags (His-tag, FLAG-tag) facilitates both detection and purification

Protein Extraction:

  • Membrane fractionation followed by detergent solubilization (e.g., with mild non-ionic detergents like Triton X-100 or DDM)

  • Care must be taken to maintain protein conformation during extraction

Purification Strategy:

  • Affinity chromatography using the introduced tag (e.g., Ni-NTA for His-tagged CidA)

  • Gel filtration to obtain monomeric CidA-His and remove aggregates

  • Confirmation of purity using SDS-PAGE and Western blot analysis

Reconstitution for Functional Studies:

  • Purified CidA can be reconstituted into liposomes composed of phospholipids like POPG [1-palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1′-rac-glycerol)]

  • This reconstitution allows for functional studies such as leakage assays to assess pore-forming ability

Successful purification has been confirmed by SDS-PAGE and Western blot analysis, with functionality assessed through liposome leakage assays .

What experimental systems can be used to test the holin-like function of CidA?

Several experimental systems have been developed to test the holin-like function of CidA:

Lysis Cassette System:
This system utilizes plasmids (e.g., pS105 derivatives) where the gene encoding CidA replaces the bacteriophage holin gene (S gene). The construct is transferred into appropriate bacterial hosts (e.g., E. coli ΔSR cells), and upon induction, cell lysis is monitored by measuring optical density. A key control includes comparing constructs with and without functional endolysin (R gene), as holin-induced lysis is dependent on endolysin activity .

Liposome Leakage Assays:

  • Purified CidA protein is reconstituted into synthetic lipid vesicles loaded with fluorescent molecules (e.g., carboxyfluorescein)

  • Pore formation is assessed by measuring the leakage of these fluorescent molecules over time

  • Different protein-to-lipid ratios can be tested to determine the efficiency of pore formation

Membrane Localization Studies:
Using fluorescently tagged CidA proteins or membrane fractionation followed by Western blot analysis to confirm membrane association, which is prerequisite for holin function .

Oligomerization Analysis:
Examining the formation of high-molecular-weight complexes using techniques like gel filtration chromatography, native PAGE, or chemical crosslinking, as holins typically function as oligomers .

These complementary approaches provide robust evidence for holin-like activity when positive results are observed across multiple systems.

How does the regulation of CidA expression affect biofilm formation and development in S. aureus?

The regulation of CidA expression has significant impacts on biofilm formation and development in S. aureus through several mechanisms:

Effect on Cell Death and DNA Release:
CidA-mediated cell death leads to the release of extracellular DNA (eDNA), which serves as a critical structural component in biofilm matrices. Mutations in cidA that reduce cell death consequently reduce eDNA release, resulting in altered biofilm architecture .

Impact on Matrix Adhesion:
Studies with cysteine mutants of CidA (affecting oligomerization) demonstrated increased biofilm adhesion in static assays, suggesting that the oligomeric state of CidA influences cell-surface interactions during initial biofilm attachment .

Accumulation of Dead Cells:
CidA regulation affects the pattern of dead cell accumulation during biofilm maturation. When CidA oligomerization was disrupted through cysteine mutations, greater amounts of dead cells accumulated during biofilm development . This suggests that proper regulation of CidA is necessary for controlling the spatial and temporal aspects of PCD during biofilm development.

Metabolic Byproduct Transport:
Beyond direct cell death regulation, CidA's role in the transport of metabolic byproducts (functioning alongside the cidABC operon) affects the local microenvironment within biofilms . This metabolic regulation can influence biofilm development by affecting nutrient availability and waste product accumulation in different biofilm regions.

These findings suggest that precise regulation of CidA expression is critical for normal biofilm development, with implications for biofilm-associated infections and antimicrobial resistance.

What is the relationship between CidA/LrgA-mediated programmed cell death and antibiotic tolerance in bacterial populations?

The relationship between CidA/LrgA-mediated programmed cell death and antibiotic tolerance is multifaceted:

Differential Antibiotic Sensitivity:
Studies have revealed that mutations in the cid and lrg operons affect antibiotic tolerance in opposite ways - cid mutations increase tolerance while lrg mutations decrease tolerance . This suggests that the balance between CidA and LrgA activity modulates population-level responses to antibiotics.

Membrane Permeability Effects:
As holin-like proteins that form membrane pores, CidA and LrgA affect membrane permeability, which can influence the entry of antibiotics into cells. The controlled expression of these proteins may create subpopulations with different membrane permeability characteristics, contributing to heterogeneous antibiotic responses within a bacterial community .

Persister Cell Formation:
The CidA/LrgA system may contribute to the formation of persister cells - metabolically dormant bacteria that can survive antibiotic treatment. By regulating programmed cell death, this system could influence which cells enter the persister state and which undergo lysis when exposed to antibiotics.

Biofilm Protection:
Within biofilms, CidA-mediated cell death contributes to the release of eDNA and other cellular components that form protective matrices. These matrices can physically restrict antibiotic penetration and bind antimicrobial compounds, reducing their effectiveness against living cells deeper in the biofilm .

Understanding these relationships could lead to novel therapeutic approaches that target the CidA/LrgA regulatory system to enhance antibiotic efficacy against resistant bacterial populations.

How do the dual functions of CidA in cell death and metabolite transport interrelate at the molecular level?

The dual functions of CidA in both programmed cell death and metabolite transport represent an intriguing aspect of its biology that researchers are still working to fully understand. Current evidence suggests several mechanisms for this interrelationship:

Shared Pore-Forming Mechanism:
The fundamental ability of CidA to form membrane pores likely underlies both functions. These pores can serve dual purposes:

  • Allowing the passage of murein hydrolases or causing membrane depolarization that activates these enzymes, leading to cell lysis

  • Facilitating the transport of metabolic byproducts such as acetate and acetoin

Environmental Sensing and Response:
The cidABC operon has been shown to affect the export of acetate and acetoin, while the lrgAB operon influences pyruvate import under low-oxygen conditions . This suggests that CidA/LrgA activity may be modulated in response to metabolic states, potentially linking decisions about cell death to the metabolic environment.

Oligomerization as a Regulatory Switch:
The oligomeric state of CidA, controlled through disulfide bonds, affects its function in cell death . It's possible that this same oligomerization process influences pore size or selectivity, thereby controlling which molecules can be transported under different conditions.

Coordinated Expression:
The regulation of cidA expression in response to environmental and metabolic cues suggests that cells coordinate both functions based on population needs. For instance, under anaerobic conditions where pyruvate transport becomes important, the relative expression or activity of CidA versus LrgA may be adjusted to meet both metabolic and PCD requirements .

This dual functionality represents an elegant example of bacterial resource economy, where the same proteins serve multiple cellular functions depending on context and oligomeric state.

What are the common pitfalls in interpreting CidA functional assays, and how can researchers avoid them?

When working with CidA functional assays, researchers should be aware of several common pitfalls:

Confounding Factors in Lysis Assays:

  • Pitfall: Attributing observed lysis solely to CidA activity without proper controls

  • Solution: Always include endolysin-negative controls (R-gene mutants) to confirm that lysis is dependent on the combination of CidA and endolysin, rather than general membrane toxicity of CidA expression

  • Pitfall: Regrowth after initial lysis (as observed with some control constructs)

  • Solution: Monitor cultures for extended periods and sequence isolates from regrowth to identify potential mutations conferring resistance

Liposome Leakage Interpretation:

  • Pitfall: Assuming all membrane disruption represents physiologically relevant pore formation

  • Solution: Use multiple fluorescent markers of different sizes to characterize pore size specificity, and compare results with biological data from cell-based assays

  • Pitfall: Not accounting for protein:lipid ratio differences between proteins

  • Solution: Test multiple protein:lipid ratios and note the minimum ratio required for activity (CidA appears to form pores at lower ratios than LrgA)

Expression Level Variations:

  • Pitfall: Inconsistent expression levels affecting functional assay results

  • Solution: Quantify protein expression using Western blotting and normalize functional data to expression levels. Consider using inducible systems with tunable expression levels

Context-Dependent Function:

  • Pitfall: Failing to account for different functions under aerobic versus anaerobic conditions

  • Solution: Clearly define growth conditions and oxygen availability in all experiments, as the cidABC and lrgAB operons show different metabolic functions under varying oxygen levels

By carefully controlling these variables and including appropriate controls, researchers can avoid misinterpretation of CidA functional data.

What methods can be used to distinguish between the cell death and metabolite transport functions of CidA in experimental settings?

Distinguishing between the cell death and metabolite transport functions of CidA requires carefully designed experiments that can isolate these distinct activities:

Genetic Separation of Functions:

  • Generate point mutations in CidA that affect one function but not the other

  • Screen for mutations that retain membrane localization but show differential effects on cell death versus metabolite transport

  • Complementation studies with these mutants can help attribute specific phenotypes to particular functions

Metabolite Transport Assays:

  • Measure uptake or export of specific metabolites (e.g., pyruvate, acetate, acetoin) using radiolabeled compounds or mass spectrometry

  • Compare transport in wild-type, cidA mutant, and complemented strains under controlled conditions

  • Crucially, perform these assays under conditions that minimize cell death (e.g., early exponential phase) to isolate transport function

Temporally Separated Analysis:

  • Monitor both cell death (via viability staining) and metabolite levels (via chromatography/mass spectrometry) throughout growth phases

  • Determine if metabolite transport occurs prior to or independent of cell death markers

  • Time-course experiments can reveal whether one function precedes the other

Membrane Potential Measurements:

  • Use membrane potential-sensitive dyes to distinguish between subtle membrane depolarization (potentially associated with metabolite transport) versus complete collapse (associated with cell death)

  • Correlate changes in membrane potential with both metabolite movement and cell viability

Conditional Expression Systems:

  • Utilize inducible promoters to express CidA at levels that permit metabolite transport but are insufficient to trigger cell death

  • This approach can establish threshold levels of CidA required for each function

By combining these approaches, researchers can dissect the relationship between CidA's dual functions and determine whether they are mechanistically linked or separable processes.

How can conflicting data between in vitro and in vivo studies of CidA function be reconciled?

Reconciling conflicting data between in vitro and in vivo studies of CidA function requires careful consideration of several factors:

Physiological Context Differences:

  • In vitro systems often lack the complex regulatory networks present in living cells

  • Solution: Use cell extracts or minimal cellular systems that maintain key regulatory components while allowing controlled manipulation of specific factors

Membrane Composition Variances:

  • Synthetic liposomes used in vitro may have different lipid compositions than native bacterial membranes

  • Solution: Adjust liposome composition to better mimic native membranes, or use membrane vesicles derived directly from bacteria

Protein Partner Interactions:

  • CidA may interact with other proteins in vivo that are absent in purified systems

  • Solution: Identify potential interaction partners using techniques like co-immunoprecipitation or bacterial two-hybrid systems, then include these partners in in vitro assays

Oligomerization State Control:

  • The oligomeric state of CidA, which depends on disulfide bond formation, may differ between in vitro and in vivo settings

  • Solution: Compare oxidizing and reducing conditions in both systems, and use cysteine mutants to control oligomerization state

Data Integration Strategies:

  • Develop mathematical models that account for differences in experimental conditions

  • Establish clear hierarchies of evidence, giving greater weight to results replicated across multiple systems

  • Design bridging experiments that systematically vary conditions between in vitro and in vivo extremes

Technical Approach:
Create a data concordance table that maps specific CidA functions across different experimental systems. For each function (pore formation, oligomerization, cell death induction, metabolite transport), note whether it is observed in each system and under what conditions. This can highlight patterns of consistency and identify specific variables that cause divergent results.

By systematically addressing these factors, researchers can develop more nuanced models of CidA function that reconcile apparently conflicting observations from different experimental systems.

What are the optimal methods for studying CidA-mediated pore formation in membranes?

Studying CidA-mediated pore formation requires specialized techniques to observe and measure membrane perforation events:

Liposome-Based Assays:

  • Fluorescent dye release assays using carboxyfluorescein-loaded liposomes reconstituted with purified CidA

  • Size-dependent dye release studies using fluorescent molecules of different molecular weights to estimate pore size

  • Real-time monitoring of dye release using fluorescence spectroscopy to determine kinetics of pore formation

Electrophysiological Approaches:

  • Planar lipid bilayer recordings to directly measure conductance changes upon CidA incorporation

  • Patch-clamp techniques adapted for bacterial systems to characterize single-channel properties

  • Construction of giant unilamellar vesicles (GUVs) with incorporated CidA for microscopy-based studies

Microscopy Techniques:

  • High-resolution microscopy (electron microscopy, atomic force microscopy) of liposomes before and after CidA exposure

  • Super-resolution fluorescence microscopy to visualize CidA clustering and pore formation in native membranes

  • Time-lapse imaging to observe dynamics of pore formation process

Molecular Dynamics Simulations:

  • In silico modeling of CidA insertion into lipid bilayers based on structural data

  • Simulation of oligomerization and pore formation events to predict pore characteristics

Optimal results are achieved by combining multiple approaches - for example, correlating functional measurements from dye release assays with structural observations from microscopy and predictions from computational modeling.

What are the most promising avenues for developing therapeutic strategies targeting CidA/LrgA systems?

Several promising therapeutic strategies targeting the CidA/LrgA system are emerging from current research:

Biofilm Dispersion Agents:

  • Compounds that modulate CidA activity could induce controlled cell death within biofilms

  • This approach could enhance antibiotic penetration by disrupting biofilm structure

  • Potential to develop combination therapies that first disperse biofilms through CidA modulation, then eliminate bacteria with conventional antibiotics

Antivirulence Approaches:

  • Inhibitors of CidA oligomerization could alter cell death patterns during infection

  • Targeting the regulatory systems controlling CidA/LrgA expression rather than directly killing bacteria may reduce selection pressure for resistance

Metabolic Intervention:

  • Exploiting the dual role of CidA/LrgA in metabolite transport to disrupt bacterial metabolism

  • Compounds that interfere with pyruvate transport through this system could be effective under low-oxygen conditions common in infections

Structural Targeting:

  • Development of peptide mimetics that interact with CidA to prevent proper pore formation

  • Small molecules designed to bind the oligomerization interfaces of CidA based on structural data

Diagnostic Applications:

  • Using knowledge of CidA/LrgA regulation to develop biomarkers for biofilm-associated infections

  • Potential for detecting specific stages of biofilm development based on CidA/LrgA expression patterns

These therapeutic strategies would benefit from further research characterizing the structure-function relationships of CidA and LrgA proteins, as well as their regulatory networks in clinically relevant settings.

How do CidA/LrgA proteins compare to functionally similar proteins in other bacterial species?

CidA/LrgA proteins represent a widely conserved family found across bacterial species, with homologs even extending to archaea and plants . Comparative analysis reveals important insights:

Conservation Across Species:

  • Homologs of CidA/LrgA have been identified in numerous bacterial species including Bacillus subtilis, Streptococcus mutans, and other Gram-positive bacteria

  • The fundamental holin-like structure featuring transmembrane domains and charged termini is preserved across species

Functional Variations:

  • In Bacillus species, LrgAB has been implicated in cell death during sporulation, with a novel ArsR family transcriptional regulator (CdsR) controlling its expression

  • In Streptococcus mutans, the LrgAB system regulates pyruvate utilization and has been shown to import pyruvate when primary carbon sources are depleted

Regulatory Differences:

  • While the core proteins share structural similarities, their regulation varies significantly between species

  • In Bacillus, CdsR directly represses lrgAB expression, and overexpression of lrgAB results in cell lysis without sporulation

  • Different environmental and metabolic cues trigger CidA/LrgA activity across species, reflecting adaptation to specific ecological niches

Evolutionary Considerations:

  • The conservation of these systems across diverse bacterial phyla suggests an ancient origin

  • The dual functions in metabolite transport and cell death control may represent an evolutionary adaptation that allowed primitive cellular death mechanisms to serve multiple purposes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.