Recombinant Holin-like protein CidA 2 (cidA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Holin-like Protein CidA 2

Holin-like protein CidA 2 (cidA2) belongs to a family of bacterial membrane proteins that function similarly to bacteriophage holins, regulating cellular death and lysis processes. CidA proteins are prototypical members of the Cid/Lrg system, which has been extensively studied in Staphylococcus aureus and other bacterial species including Bacillus anthracis and Bacillus cereus . These proteins serve as critical molecular switches that control murein hydrolase activity and influence biofilm development, antibiotic tolerance, and other cellular functions .

The cidA gene encodes a holin-like protein with positive effects on murein hydrolase activity, while its counterpart, lrgA, encodes an antiholin-like protein that inhibits these enzymes . This balanced regulatory system is fundamental to bacterial cell wall integrity and programmed cell death processes, making CidA2 proteins significant subjects for microbiological research and potential therapeutic targeting.

Primary Structure and Domain Organization

CidA2 proteins share several defining structural characteristics with other holin-like proteins. The recombinant forms of CidA2 from both Bacillus anthracis and Bacillus cereus consist of 118 amino acids . These proteins exhibit structural features typical of bacteriophage holins, including:

  1. Relatively small size

  2. Two to three putative transmembrane domains

  3. Charge-rich N and C termini

Membrane Association and Oligomerization

CidA proteins, including CidA2, are membrane-associated proteins that integrate into the bacterial cytoplasmic membrane . A significant characteristic of these proteins is their ability to oligomerize into high-molecular-mass complexes. This oligomerization process depends on disulfide bonds formed between cysteine residues, which appears to be crucial for regulating their function .

Membrane fractionation and fluorescent protein fusion studies have confirmed that CidA proteins localize to the bacterial membrane, positioning them appropriately for their regulatory functions in cell wall dynamics .

Role in Cell Death and Lysis

CidA2, like other CidA proteins, functions as a holin-like regulator of bacterial cell death and lysis. Studies on CidA proteins have demonstrated that they positively influence extracellular murein hydrolase activity . Murein hydrolases are enzymes that break down peptidoglycan in the bacterial cell wall, and their regulation is critical for cell division, growth, and programmed cell death.

Research with cidA mutants in S. aureus has shown decreased extracellular murein hydrolase activity compared to wild-type strains, confirming the enhancing role of cidA gene products on these enzymes .

Impact on Antibiotic Sensitivity

One particularly significant function of CidA proteins is their influence on bacterial sensitivity to antibiotics, especially β-lactams such as penicillin. Analysis of cidA mutants has revealed decreased sensitivity to the killing effects of penicillin, suggesting that CidA proteins naturally promote antibiotic susceptibility .

Studies have demonstrated that mutations in the cid operon increased antibiotic tolerance, while mutations in the lrg operon decreased tolerance, highlighting the opposing roles of these systems in antibiotic response mechanisms .

Role in Biofilm Development

CidA proteins play crucial roles in biofilm formation and maturation. Research has demonstrated that disruption of CidA function, particularly through mutation of cysteine residues involved in oligomerization, affects biofilm adhesion and the accumulation of dead cells during biofilm maturation .

The regulation of cell death and lysis within biofilms is essential for proper biofilm architecture and function, making CidA2 and related proteins important factors in bacterial community behavior.

Expression Systems and Purification

Recombinant CidA2 proteins have been successfully produced using Escherichia coli expression systems. Two specific variants have been documented:

  1. Recombinant Full Length Holin-Like Protein CidA 2 from Bacillus anthracis (His-Tagged)

  2. Recombinant Full Length Holin-Like Protein CidA 2 from Bacillus cereus (His-Tagged)

Both recombinant proteins are produced as full-length proteins (1-118 amino acids) with histidine tags to facilitate purification and detection .

Properties of Recombinant CidA2

The recombinant forms of CidA2 retain the functional and structural characteristics of the native protein while providing additional advantages for research applications. The histidine tag enables efficient purification using immobilized metal affinity chromatography (IMAC) without significantly altering the protein's functional properties.

Basic Research Applications

Recombinant CidA2 proteins serve as valuable tools for investigating fundamental aspects of bacterial physiology, particularly:

  1. Mechanisms of programmed cell death in bacteria

  2. Regulation of cell wall dynamics and integrity

  3. Biofilm formation and development

  4. Antibiotic resistance mechanisms

The availability of purified recombinant CidA2 enables detailed biochemical and structural studies that would be difficult to perform with endogenous proteins in their native bacterial contexts.

Potential Therapeutic Applications

Understanding CidA2 function has potential implications for developing novel antimicrobial strategies. Since CidA proteins influence bacterial sensitivity to antibiotics and biofilm formation, they represent potential targets for therapeutic intervention . Compounds that modulate CidA2 function might serve as adjuvants to enhance the efficacy of existing antibiotics or as standalone agents to compromise bacterial viability.

Species-Specific Variations

While the core functions of CidA proteins appear conserved across bacterial species, there are notable differences between CidA2 from different sources. The recombinant CidA2 proteins available from Bacillus anthracis and Bacillus cereus have similar lengths (118 amino acids) but may exhibit species-specific functional variations .

The Cid/Lrg system was initially characterized in Staphylococcus aureus, but homologous systems exist in various bacterial species, suggesting evolutionary conservation of this regulatory mechanism .

Comparative Expression Patterns

In S. aureus, the cidAB operon is maximally expressed during early exponential growth, which is opposite to the expression pattern observed for the lrgAB operon . This temporal separation of expression suggests that the balance between CidA and LrgA activities is dynamically regulated throughout the bacterial growth cycle.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cidA2; BA_3885; GBAA_3885; BAS3599; Holin-like protein CidA 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
cidA2
Target Protein Sequence
MKYVMLLLQVGVLYVFSLVGTWIQGVFHLSMPGSLIGMLMLFLLLSTRILPLKWFEEGAE KLLVFLPLFLIPSTTGLMEYESFLFSKGSIIFLLVVISTVVTLIVSGYISQLLVTSKK
Uniprot No.

Target Background

Function
CidA2 enhances the activity of extracellular murein hydrolases, possibly by mediating their export through hole formation. Its function is inhibited by the antiholin-like proteins LrgAB. In an unstressed cell, the LrgAB products likely inhibit CidA protein activity. When a cell is subjected to stress, such as antibiotic exposure or other environmental factors, CidA potentially oligomerizes within the bacterial cell membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also hypothesized to regulate subsequent cell lysis by either providing murein hydrolases access to the cell wall substrate or by modulating their activity through a potential change in cell wall pH resulting from loss of membrane potential.
Database Links

KEGG: ban:BA_3885

STRING: 260799.BAS3599

Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CidA protein and how is it classified?

CidA is a membrane-associated protein encoded by the cidABC operon in Staphylococcus aureus that exhibits holin-like properties. It belongs to a well-conserved family of proteins involved in programmed cell death (PCD) in bacteria. CidA shares significant structural similarities with bacteriophage holins, which are small transmembrane proteins that create pores in bacterial membranes during the final stages of the bacteriophage reproductive cycle. These proteins are characterized by having at least one transmembrane α-helical segment and the ability to form membrane pores that facilitate bacterial lysis .

What is the functional relationship between CidA and LrgA proteins?

CidA and LrgA represent a functionally antagonistic pair of proteins in S. aureus, with CidA exhibiting holin-like properties and LrgA displaying antiholin-like activities. Both proteins accumulate in the bacterial membrane, but they exert opposing effects on cell death and lysis processes. When expressed, CidA promotes cell lysis by forming pores in the cytoplasmic membrane, while LrgA acts to inhibit this process. This molecular antagonism creates a regulatory system that controls the timing and extent of cell death and lysis in bacterial populations, similar to the holin-antiholin systems observed in bacteriophages .

How does CidA contribute to bacterial physiology?

CidA plays crucial roles in multiple aspects of bacterial physiology:

  • Programmed cell death: Functions as a key regulator of bacterial programmed cell death processes, controlling population dynamics in bacterial communities

  • Biofilm development: Influences biofilm adhesion in static assays and contributes to dead-cell accumulation during biofilm maturation

  • Membrane disruption: Forms pores in the cytoplasmic membrane, allowing for the release of cellular contents, as demonstrated by its ability to cause leakage of small molecules from membrane vesicles

  • Lytic control: Regulates cell lysis processes in a manner analogous to bacteriophage holins, supporting endolysin-induced cell lysis when properly expressed

What is known about the structural characteristics of CidA?

The CidA protein possesses several key structural features that define its function:

  • Transmembrane domains: Contains multiple putative transmembrane domains that anchor it within the bacterial membrane, typically two to three transmembrane segments

  • Charge-rich termini: Features charged N and C termini, similar to bacteriophage holins

  • Oligomerization capacity: Forms high-molecular-mass complexes through oligomerization, a process dependent on disulfide bonds between cysteine residues

  • Small size: Relatively small protein size, consistent with other holin family members

These structural characteristics enable CidA to integrate into bacterial membranes and form functional pores under specific conditions, contributing to its role in membrane disruption and cell death regulation.

How does CidA oligomerization affect its function?

The oligomerization of CidA into higher-order complexes through disulfide bonds between cysteine residues significantly impacts its functional properties:

  • Regulatory impact: Oligomerization appears to have a negative impact on cell lysis processes. When cysteine mutant alleles that disrupt normal oligomerization were introduced into S. aureus, increased cell lysis during stationary phase was observed

  • Biofilm effects: Mutations affecting oligomerization led to increased biofilm adhesion in static assays and greater accumulation of dead cells during biofilm maturation, suggesting oligomerization modulates CidA's activity in biofilm contexts

  • Pore formation: The oligomerization process likely represents a key step in the formation of functional membrane pores, similar to the oligomerization observed in bacteriophage holins prior to hole formation

These findings suggest that the oligomerization state of CidA serves as an important regulatory mechanism controlling its membrane-disrupting activities.

What expression systems are recommended for recombinant CidA production?

Producing recombinant CidA presents significant challenges due to its membrane-disrupting properties, which can be toxic to expression hosts. Researchers should consider the following approaches:

  • Inducible expression systems: Use tightly regulated expression systems that allow precise control over CidA production, preventing premature toxicity to the host

  • Fusion protein strategies: Express CidA as a fusion protein with solubility-enhancing tags that may reduce toxicity and improve yields

  • Cell-free protein synthesis: Consider cell-free protein synthesis systems that circumvent the toxicity issues associated with expressing membrane-disrupting proteins in living cells

  • Specialized host strains: Employ host strains specifically designed for toxic protein expression that contain mutations affecting membrane integrity or that express natural inhibitors of holin activity

The challenges of obtaining sufficient quantities of recombinant holins like CidA have significantly hindered the structural and functional analysis of these proteins compared to other cell lytic proteins, making the choice of expression system particularly critical .

What methods can be used to study CidA membrane localization and pore formation?

Several experimental approaches can effectively demonstrate CidA's membrane localization and pore-forming capabilities:

Membrane Localization Studies:

  • Membrane fractionation: Separate cellular components to isolate membrane fractions and detect CidA using immunoblotting techniques

  • Fluorescent protein fusions: Generate CidA-fluorescent protein fusions to visualize its localization within living cells using fluorescence microscopy

Pore Formation Assessment:

  • Lysis cassette systems: Employ bacteriophage-derived lysis cassette systems that can demonstrate CidA's ability to support endolysin-induced cell lysis, a hallmark of holin function

  • Membrane vesicle leakage assays: Prepare membrane vesicles containing CidA and measure the leakage of small molecules to directly assess pore formation capacity

  • Dinitrophenol triggering: Test CidA's response to the uncoupler dinitrophenol, which can trigger premature membrane disruption in functional holins

These methodologies provide complementary approaches to characterize both the localization and functional pore-forming activities of CidA proteins.

How can researchers assess the impact of CidA on bacterial biofilm formation?

To evaluate CidA's role in biofilm development, researchers can implement the following methodologies:

  • Static biofilm assays: Quantify biofilm adhesion in wild-type versus cidA mutant strains using crystal violet staining to measure biomass accumulation

  • Live/dead cell staining: Assess the proportion of dead cells within biofilms using fluorescent viability dyes to determine how CidA affects cell death during biofilm maturation

  • β-galactosidase release assays: Measure the release of cytoplasmic enzymes like β-galactosidase to quantify cell lysis during biofilm development

  • Confocal microscopy analysis: Examine the three-dimensional structure of biofilms formed by wild-type and cidA mutant strains to assess differences in architecture and cellular distribution

These approaches provide quantitative and qualitative measures of how CidA influences biofilm development, maturation, and the accumulation of dead cells within biofilm structures.

How can targeted mutations in the cidA gene inform our understanding of protein function?

Mutational analysis of the cidA gene has proven valuable for elucidating structure-function relationships:

  • Cysteine residue mutations: Replacing cysteine residues involved in disulfide bond formation has demonstrated their importance in CidA oligomerization and function. This approach revealed that disrupting normal oligomerization increases cell lysis during stationary phase

  • Transmembrane domain alterations: Mutations targeting the putative transmembrane domains can help define which regions are critical for membrane integration and pore formation

  • Allelic replacement: Generating S. aureus strains in which the wild-type copy of the cidA gene is replaced with mutant alleles allows for in vivo assessment of how specific mutations affect cell physiology, biofilm formation, and lysis patterns

These mutational approaches provide insights into which structural features of CidA are essential for its holin-like activities and how alterations in protein structure translate to functional changes in bacterial physiology.

What genetic tools are available for cidA manipulation in S. aureus?

Several genetic tools have been successfully applied to manipulate cidA expression and function in S. aureus:

  • Allelic replacement techniques: Methods for precise replacement of the wild-type cidA gene with mutated versions, allowing for in vivo analysis of specific mutations

  • Inducible expression systems: Plasmid-based systems that allow controlled expression of cidA or its variants, crucial for studying toxic membrane proteins

  • Fluorescent protein fusions: Genetic constructs that fuse fluorescent reporter proteins to CidA, enabling visualization of protein localization and expression patterns

  • Lysis cassette systems: Genetic tools derived from bacteriophage lysis systems that can be adapted to test CidA's holin-like functions in supporting endolysin-induced cell lysis

These genetic tools provide researchers with options for manipulating cidA expression and structure to investigate its roles in various cellular processes.

How does CidA function compare across different bacterial species?

While CidA was initially characterized in Staphylococcus aureus, holin-like proteins have been identified in numerous bacterial species with varying functional characteristics:

  • Conservation of mechanism: The basic holin-like function of forming membrane pores appears to be conserved across different bacterial species containing CidA homologs, suggesting fundamental evolutionary conservation of this mechanism

  • Species-specific roles: The precise physiological roles of CidA-like proteins may vary between species, with some emphasizing roles in biofilm formation, others in stress response, and others in carbohydrate metabolism

  • Regulatory differences: The regulatory networks controlling CidA expression and activity differ between bacterial species, reflecting adaptation to different ecological niches and physiological requirements

Comparative studies of CidA function across bacterial species can provide insights into both conserved mechanistic features and species-specific adaptations of these membrane-disrupting proteins.

What is the relationship between CidA and bacterial metabolism?

Recent research has revealed unexpected connections between CidA/LrgA proteins and bacterial metabolism:

  • Pyruvate utilization: The LrgAB proteins (functional antagonists of CidA) have been implicated in the transport of pyruvate during microaerobic and anaerobic growth conditions in S. aureus

  • Carbohydrate metabolism: Homologs of CidA/LrgA in other bacterial and plant species are involved in the transport of by-products of carbohydrate metabolism, suggesting broader metabolic roles beyond cell death regulation

  • Small molecule transport: Both CidA and LrgA localize to membrane vesicles and affect the transport of small molecules across membranes, potentially influencing various metabolic processes

These findings suggest that the CidA/LrgA system may have evolved from proteins initially involved in metabolite transport, later adopting specialized roles in cell death regulation while maintaining some of their original transport functions.

What are the potential biotechnological applications of recombinant CidA?

The unique properties of CidA as a membrane-disrupting protein open several potential biotechnological applications:

  • Antimicrobial development: The pore-forming ability of CidA could be harnessed in designing novel antimicrobial agents that target bacterial membranes

  • Controlled lysis systems: Engineered CidA variants could be developed for biotechnological applications requiring controlled bacterial lysis, such as protein release or DNA extraction

  • Biofilm control strategies: Given CidA's role in biofilm development, engineered versions might be useful in controlling unwanted biofilm formation in industrial or medical settings

  • Small molecule delivery systems: The ability of CidA to form membrane pores could potentially be exploited for delivering therapeutic molecules across bacterial membranes

While technical challenges related to protein toxicity and production must be addressed, the unique membrane-disrupting properties of CidA hold promise for various biotechnological applications.

How can contradictory findings regarding CidA function be reconciled?

Researchers studying CidA may encounter apparently contradictory results due to several factors:

  • Experimental conditions: Differences in growth conditions, media composition, or oxygen availability can significantly impact CidA function and the phenotypes of cidA mutants

  • Strain variation: Genetic background differences between bacterial strains may influence CidA activity through interactions with strain-specific factors

  • Methodology differences: Variations in experimental approaches for assessing cell lysis, membrane integrity, or biofilm formation can lead to seemingly discrepant results

  • Complex regulatory networks: The activity of CidA is influenced by complex regulatory networks that may respond differently under various experimental conditions

To reconcile contradictory findings, researchers should carefully document experimental conditions, use multiple complementary methods to assess CidA function, and consider how strain-specific factors might influence experimental outcomes.

What are the key considerations when analyzing the effects of CidA mutations?

When analyzing the effects of CidA mutations, researchers should consider:

  • Direct vs. indirect effects: Distinguish between phenotypes directly caused by altered CidA function versus indirect effects resulting from compensatory responses or downstream pathway disruptions

  • Complementation controls: Verify that phenotypes can be complemented by providing the wild-type gene in trans to confirm that observed effects are specifically due to the mutation of interest

  • Dosage effects: Consider how expression levels of mutant CidA proteins might influence phenotypes, as both absence and overexpression may yield informative but different results

  • Structural consequences: Assess how specific mutations affect protein structure, oligomerization, membrane integration, and pore formation to connect structural changes to functional outcomes

What are the most promising future research directions for CidA studies?

Several exciting research directions may advance our understanding of CidA and related holin-like proteins:

  • Structural biology approaches: Developing methods to overcome the technical challenges of expressing and purifying membrane proteins like CidA could enable detailed structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy

  • Single-molecule analyses: Applying single-molecule techniques to study the dynamics of CidA pore formation in real-time could provide unprecedented insights into the mechanism of membrane disruption

  • Systems biology integration: Investigating how CidA functions within broader regulatory networks controlling cell death, metabolism, and biofilm formation may reveal new aspects of bacterial physiology

  • Comparative genomics: Expanding studies of CidA homologs across diverse bacterial species could illuminate the evolutionary history and functional diversification of these proteins

These research directions promise to deepen our understanding of CidA's fundamental biology while potentially revealing new applications in biotechnology and medicine.

What technological advances are needed to overcome current research limitations?

Advancing CidA research will require several technological innovations:

  • Improved membrane protein expression systems: Development of specialized expression systems that can produce toxic membrane proteins like CidA in sufficient quantities for detailed structural and biochemical analyses

  • Advanced imaging techniques: Higher-resolution imaging methods to visualize CidA localization, oligomerization, and pore formation in native membrane environments

  • Real-time monitoring systems: Technologies for real-time monitoring of membrane integrity, pore formation, and small molecule transport in live bacterial cells

  • Computational modeling: More sophisticated computational approaches to predict membrane protein structure, dynamics, and interactions based on limited experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.