Recombinant Hordeum vulgare Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Hordeum vulgare (Barley)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLAFQSYRPDKKNILVIGPVPG KKYSEIVFPILSPDPATKKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVR KILRKEKGGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKIDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its role in Hordeum vulgare?

Apocytochrome f is the precursor form of cytochrome f, a crucial component of the cytochrome b6f complex that mediates electron transfer between photosystem II and photosystem I in the photosynthetic electron transport chain. In Hordeum vulgare (barley), this protein is encoded by the petA gene located in the chloroplast genome. The mature cytochrome f functions as an electron carrier with a heme prosthetic group that undergoes oxidation and reduction during photosynthesis. The protein plays a vital role in proton translocation across the thylakoid membrane, contributing to the generation of proton motive force necessary for ATP synthesis. Unlike most nuclear-encoded chloroplast proteins, petA is synthesized within the chloroplast and is subject to organelle-specific transcriptional regulation similar to that observed in other plants like Arabidopsis, where RNA polymerases such as RpoT;2 may affect organellar gene expression .

What expression systems are most effective for recombinant production of barley Apocytochrome f?

Several expression systems have demonstrated efficacy for recombinant production of barley chloroplast proteins. The baculovirus-insect cell system has proven effective for expressing functional barley proteins as demonstrated with ADP-glucose pyrophosphorylase . For membrane proteins like Apocytochrome f, E. coli-based systems using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression can be utilized when codon optimization is implemented. An effective approach combines a pET-based vector with an N-terminal His-tag for purification, similar to the method used for barley AGPase . Alternative systems include yeast (Pichia pastoris) for eukaryotic processing capabilities and cell-free expression systems for difficult-to-express proteins. The choice of expression system should be guided by the specific research objectives, as each system presents different post-translational modification capabilities and protein folding environments.

What purification methods yield the highest purity of recombinant Hordeum vulgare Apocytochrome f?

The most effective purification strategy employs affinity chromatography utilizing a histidine tag, followed by additional chromatographic steps. The primary method involves:

  • Ni²⁺-NTA agarose chromatography using a hexahistidine tag attached to either the N-terminus or C-terminus of Apocytochrome f

  • Ion exchange chromatography (typically DEAE for negative charge separation)

  • Size exclusion chromatography for final polishing and buffer exchange

For improved yield and purity, consider these protocol optimizations:

Purification StepOptimization StrategyExpected Improvement
Cell lysisAddition of 1% mild detergent (DDM or LDAO)Enhanced membrane protein solubilization
Affinity bindingInclusion of 5-10% glycerol in buffersImproved protein stability
Elution conditionsLinear imidazole gradient (20-250 mM)Reduction of non-specific binding
Post-purificationOvernight dialysis against low-salt bufferRemoval of imidazole for downstream applications

This multi-step approach typically yields protein with >95% purity suitable for structural and functional studies, while maintaining the native confirmation required for activity assays.

How can researchers assess the functional integrity of recombinant Apocytochrome f compared to native protein?

Functional assessment of recombinant Apocytochrome f requires multiple analytical approaches to compare with the native form:

  • Spectroscopic analysis: UV-visible absorption spectroscopy to identify characteristic peaks at approximately 420 nm (Soret band) and 550 nm (α-band) when reduced, confirming proper heme incorporation. Shifts in these peaks can indicate structural perturbations.

  • Redox potential measurements: Cyclic voltammetry to determine if the recombinant protein exhibits the expected midpoint redox potential (approximately +350 mV at pH 7.0), which is critical for its electron transfer function.

  • Electron transfer kinetics: Stopped-flow spectroscopy to measure electron transfer rates between recombinant Apocytochrome f and its physiological partners (plastocyanin or cytochrome c6).

  • Structural analysis: Circular dichroism spectroscopy to assess secondary structure composition, comparing α-helical content between recombinant and native proteins.

  • Integration assays: Reconstitution experiments with isolated thylakoid membranes to determine if the recombinant protein can functionally complement membranes depleted of cytochrome f.

These methodological approaches provide a comprehensive functional profile that can identify any discrepancies between recombinant and native forms, particularly important when investigating structure-function relationships in mutational studies .

What strategies effectively overcome expression challenges for Hordeum vulgare petA in heterologous systems?

Expression of functional barley Apocytochrome f presents several challenges due to its membrane association, cofactor requirements, and specialized folding needs. Effective strategies include:

  • Codon optimization: Analyze and adjust the codon usage bias of the barley petA gene to match the expression host, particularly focusing on rare codons at the N-terminus that can impede translation initiation.

  • Fusion partners: Employ solubility-enhancing fusion tags such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) with engineered protease cleavage sites for tag removal after purification.

  • Host strain engineering: For E. coli expression, utilize specialized strains that co-express rare tRNAs (e.g., Rosetta) and chaperones (e.g., GroEL/GroES) to facilitate proper folding.

  • Expression conditions optimization:

ParameterOptimization RangeEffect on Expression
Temperature16-20°CSlows expression rate, improves folding
Inducer concentration0.1-0.5 mM IPTGBalances expression level with toxicity
Media compositionSupplemented with δ-ALA (heme precursor)Enhances cofactor incorporation
Expression duration16-24 hoursAllows sufficient time for protein maturation
  • Membrane mimetics: Incorporate detergents or lipids during purification to maintain the native conformation of this membrane protein, similar to approaches used for other challenging membrane proteins .

These comprehensive strategies have been shown to increase yield and maintain the structural integrity of complex chloroplast proteins when applied to heterologous expression systems.

How can site-directed mutagenesis of Apocytochrome f be optimized to study electron transfer mechanisms?

Site-directed mutagenesis represents a powerful approach to probe the electron transfer function of Apocytochrome f. Optimization of this methodology includes:

  • Target residue selection: Focus on conserved residues identified through multiple sequence alignments of petA across species. Key targets include:

    • Heme-binding residues (His and Cys ligands)

    • Surface-exposed charged residues potentially involved in protein-protein interactions

    • Residues in the predicted electron transfer pathway

  • Mutagenesis strategy:

    • For conservative substitutions, employ QuikChange PCR-based methods

    • For introduction of unnatural amino acids, use amber suppression technology with specialized tRNA/synthetase pairs

    • For extensive modifications, consider Gibson Assembly methods that allow seamless introduction of multiple mutations

  • Validation approaches:

    • Sequence verification of the entire petA coding region to confirm target mutations and absence of secondary mutations

    • Protein expression level comparison between wild-type and mutant constructs using Western blotting

    • Structural integrity assessment using thermal shift assays or limited proteolysis

  • Functional characterization:

    • Laser flash photolysis to measure electron transfer kinetics in mutant variants

    • Protein-protein interaction analysis using isothermal titration calorimetry or surface plasmon resonance

    • In vitro reconstitution with partner proteins to evaluate effects on complex assembly

This systematic approach to mutagenesis has revealed critical insights into electron transfer mechanisms in other photosynthetic proteins and can be directly applied to barley Apocytochrome f research .

What experimental controls are essential when studying recombinant Hordeum vulgare Apocytochrome f?

Robust experimental design for recombinant Apocytochrome f research requires implementation of multiple control measures:

  • Expression controls:

    • Empty vector transformants to assess background expression

    • GFP-fusion constructs to monitor expression efficiency and localization

    • Established recombinant protein (e.g., cytochrome c) expressed under identical conditions as a procedural control

  • Functional controls:

    • Native barley thylakoid membranes as a positive control for activity assays

    • Heat-denatured recombinant protein as a negative control

    • Competitive inhibitors of cytochrome f function to validate assay specificity

  • Structural controls:

    • Circular dichroism measurements before and after experimental manipulations to confirm structural integrity

    • Size exclusion chromatography to verify monodispersity and absence of aggregation

    • Heme incorporation assessment through absorbance ratios (A₄₂₀/A₂₈₀)

  • System-specific controls:

    • For in vivo studies, include RpoT;2 mutant backgrounds that affect chloroplast gene expression

    • For electron transport studies, include antimycin A or DBMIB treatments to block specific segments of the electron transport chain

Implementation of these controls ensures reliable data interpretation and facilitates troubleshooting when unexpected results are encountered.

How can researchers effectively analyze the interaction between recombinant Apocytochrome f and plastocyanin/cytochrome c6?

Investigating protein-protein interactions between Apocytochrome f and its electron transfer partners requires multiple complementary approaches:

  • Co-immunoprecipitation studies:

    • Use anti-His antibodies to pull down His-tagged Apocytochrome f and probe for co-precipitation of plastocyanin

    • Reverse the approach using plastocyanin-specific antibodies to validate the interaction

  • Surface plasmon resonance (SPR) analysis:

    • Immobilize recombinant Apocytochrome f on a sensor chip

    • Measure association and dissociation kinetics of plastocyanin/cytochrome c6 under varying conditions

    • Determine binding affinity constants (KD) and compare across different redox states

  • Microscale thermophoresis (MST):

    • Label either protein with a fluorescent dye

    • Measure binding interactions in solution, avoiding potential artifacts from surface immobilization

    • Determine binding constants under near-physiological conditions

  • In vitro electron transfer kinetics:

    • Use stopped-flow spectroscopy to measure electron transfer rates

    • Analyze how mutations affect binding versus electron transfer steps

    • Construct Lineweaver-Burke plots to determine kinetic parameters

  • Cross-linking mass spectrometry:

    • Apply chemical cross-linkers to capture transient interactions

    • Identify interacting residues through mass spectrometry analysis

    • Generate distance constraints for computational modeling

These methodologies have proven successful in characterizing interactions between photosynthetic electron transfer proteins and can be applied to barley systems to understand species-specific interaction determinants.

What high-throughput screening methods can assess the impact of mutations on Apocytochrome f function?

High-throughput evaluation of Apocytochrome f variants requires efficient screening methods that balance throughput with functional relevance:

  • Activity-based screening platforms:

    • Develop a coupled enzyme assay where electron transfer from Apocytochrome f to plastocyanin is linked to a colorimetric or fluorescent readout

    • Implement in a 96-well format for rapid assessment of multiple variants

  • Thermal stability screening:

    • Utilize differential scanning fluorimetry (DSF) to assess protein stability changes

    • Correlate stability shifts with functional impact using a subset of validated mutants

    • Screen hundreds of variants in a single microplate run

  • Redox-sensitive reporter systems:

    • Engineer yeast or bacterial systems where electron transfer activity is coupled to a selectable or screenable phenotype

    • Develop split-protein complementation assays where interaction restores reporter enzyme function

  • Deep mutational scanning:

    • Generate libraries of thousands of Apocytochrome f variants

    • Apply selection pressure based on function in appropriate host systems

    • Use next-generation sequencing to identify enriched or depleted variants

  • Automated structural analysis:

    • Implement high-throughput circular dichroism spectroscopy

    • Develop rapid heme incorporation assays based on spectroscopic signatures

    • Use robotic liquid handling for consistent protein preparation

This multi-faceted approach allows researchers to move beyond single-mutation analysis to comprehensively map the sequence-function relationship of Apocytochrome f, similar to approaches used for other complex proteins in barley .

How should researchers address inconsistencies between in vitro and in vivo functional data for recombinant Apocytochrome f?

When confronted with discrepancies between in vitro and in vivo functional assessments of recombinant Apocytochrome f, a systematic troubleshooting approach is required:

  • Evaluate experimental conditions:

    • Compare buffer compositions used in vitro with physiological chloroplast conditions

    • Assess whether redox potential differences exist between experimental systems

    • Determine if important cofactors or interaction partners are missing in vitro

  • Consider post-translational modifications:

    • Analyze whether the recombinant protein lacks critical modifications present in vivo

    • Investigate if the heme group is properly incorporated and oriented

    • Examine potential differences in protein folding environments

  • Analyze protein dynamics:

    • Use hydrogen-deuterium exchange mass spectrometry to compare conformational dynamics

    • Implement molecular dynamics simulations to identify environment-dependent conformational changes

    • Assess whether membrane interactions affect protein behavior differently between systems

  • Conduct bridging experiments:

    • Perform reconstitution studies with isolated thylakoid membranes

    • Develop semi-in vitro systems using lysed chloroplasts

    • Use permeabilized cells to enable controlled introduction of recombinant proteins

  • Statistical reconciliation approaches:

    • Apply Bayesian methods to integrate discrepant datasets

    • Develop mathematical models that account for differences in experimental conditions

    • Use meta-analysis techniques when multiple datasets are available

This systematic approach has successfully resolved similar discrepancies in studies of other chloroplast proteins and can be directly applied to Apocytochrome f research challenges .

What bioinformatic tools best support structure-function analysis of Hordeum vulgare Apocytochrome f?

Comprehensive structure-function analysis of barley Apocytochrome f benefits from an integrated bioinformatics workflow:

  • Sequence analysis tools:

    • MEGA X for phylogenetic analysis comparing petA across species

    • ConSurf for evolutionary conservation mapping onto protein structures

    • PROVEAN/SIFT/PolyPhen-2 for predicting functional impacts of mutations

  • Structural prediction and analysis:

    • AlphaFold2 for generating high-confidence structural models specific to barley Apocytochrome f

    • PyMOL/Chimera for visualization and comparative structural analysis

    • CASTp for identification of potential binding pockets and channels

  • Molecular dynamics simulations:

    • GROMACS with specialized force fields for heme-containing proteins

    • Normal mode analysis for identifying functionally relevant protein motions

    • Free energy calculations for quantifying binding energetics

  • Electron transfer pathway prediction:

    • HARLEM/PATHWAYS for identifying potential electron transfer routes

    • eMap for electrostatic surface mapping relevant to protein-protein interactions

    • QM/MM methods for detailed electronic structure of the active site

  • Integrative data analysis platforms:

    • Cytoscape for network analysis of protein-protein interactions

    • R/Python with BioConductor/Biopython for custom analysis pipelines

    • Jupyter notebooks for reproducible data analysis and visualization

This comprehensive bioinformatics toolkit enables researchers to develop testable hypotheses about structure-function relationships in Apocytochrome f, guiding experimental design for efficient research progress .

How can researchers differentiate between direct and indirect effects of Apocytochrome f mutations on photosynthetic electron transport?

Distinguishing direct from indirect effects of Apocytochrome f mutations requires a multi-level experimental approach:

  • Isolated protein studies:

    • Direct measurement of electron transfer rates between purified components

    • Binding affinity determination using SPR or ITC under controlled redox states

    • Spectroscopic analysis of heme environment in mutant proteins

  • Reconstitution experiments:

    • Systematic reconstruction of the electron transport chain from purified components

    • Step-by-step addition of components to identify where defects manifest

    • Comparison of activity in minimal versus complete systems

  • In vivo correlation analysis:

    • Quantitative phenotyping of mutant lines with varying Apocytochrome f modifications

    • Time-resolved measurements to differentiate primary and secondary effects

    • Correlation analysis between molecular phenotypes and physiological outcomes

  • Compensatory mutation approach:

    • Introduction of second-site mutations in interaction partners

    • Testing for functional rescue that would indicate direct interaction effects

    • Creation of chimeric proteins to map interaction domains

  • Multi-omics integration:

    • Transcriptomic analysis to identify compensatory responses

    • Metabolomic profiling to detect metabolic adjustments to electron transport defects

    • Flux analysis to quantify changes in electron flow through alternative pathways

This systematic approach has been successfully applied to distinguish direct and indirect effects in other components of the photosynthetic apparatus and can be similarly applied to Apocytochrome f research .

How can CRISPR-Cas technology be optimized for editing the chloroplast petA gene in Hordeum vulgare?

  • Chloroplast-targeted CRISPR systems:

    • Engineer nuclear-encoded Cas9 with chloroplast transit peptides for organelle localization

    • Optimize codon usage of Cas9 for efficient expression in barley

    • Utilize specialized promoters like RpoT;2-responsive elements for expression

  • Guide RNA design considerations:

    • Select target sites unique to petA to avoid off-target effects on similar sequences

    • Incorporate structural modifications to gRNAs for enhanced stability in chloroplasts

    • Design multiple gRNAs targeting different regions of petA to increase editing efficiency

  • Delivery methods optimization:

    • Biolistic transformation for direct delivery to chloroplasts

    • Agrobacterium-mediated transformation for nuclear-encoded, chloroplast-targeted systems

    • Protoplast-based approaches for initial validation of editing efficiency

  • Selection strategies:

    • Develop spectinomycin resistance markers for chloroplast transformation selection

    • Implement co-editing strategies where visible phenotypes aid in identification of edited plants

    • Utilize PCR-restriction fragment length polymorphism (PCR-RFLP) for rapid screening

  • Homology-directed repair enhancement:

    • Provide repair templates with extended homology arms (>500 bp)

    • Co-express recombination enhancers like RecA with chloroplast targeting

    • Optimize timing of template delivery relative to CRISPR components

This methodology builds upon successful plastome editing in other plant species and adapts it to the specific challenges of the barley chloroplast genome, providing a foundation for precise petA modification.

What opportunities exist for using recombinant Apocytochrome f to improve photosynthetic efficiency in crop plants?

Recombinant Apocytochrome f presents several opportunities for enhancing photosynthetic efficiency through both fundamental research and applied approaches:

  • Cytochrome b6f complex optimization:

    • Engineer Apocytochrome f variants with altered redox properties to modify electron flow rates

    • Introduce mutations that reduce susceptibility to photoinhibition under stress conditions

    • Test modifications that could reduce electron leakage to oxygen, decreasing reactive oxygen species production

  • Synthetic biology approaches:

    • Design chimeric cytochrome proteins incorporating beneficial features from diverse species

    • Create optimized cytochrome b6f complexes with enhanced stability under elevated temperatures

    • Engineer regulatory switches that modify electron transport in response to environmental conditions

  • Research applications:

    • Develop biosensors using recombinant Apocytochrome f to monitor electron transport efficiency

    • Create in vitro systems to screen for compounds that enhance cytochrome b6f activity

    • Establish platforms for studying the effects of environmental stressors on electron transport

  • Translational potential:

    • Identify natural Apocytochrome f variants with enhanced performance under specific conditions

    • Screen germplasm collections for beneficial petA alleles that could be introduced to elite cultivars

    • Develop comprehensive models of how cytochrome b6f modifications affect whole-plant photosynthesis

These approaches offer significant potential for crop improvement, particularly for enhancing photosynthetic efficiency under suboptimal conditions, potentially building on successful strategies employed in barley resistance gene research .

How might structural biology techniques advance our understanding of recombinant Hordeum vulgare Apocytochrome f?

Advanced structural biology techniques offer transformative potential for elucidating the detailed molecular mechanisms of barley Apocytochrome f:

  • Cryo-electron microscopy (cryo-EM):

    • Determine high-resolution structure of the entire cytochrome b6f complex with barley-specific components

    • Visualize conformational changes during electron transfer using time-resolved cryo-EM

    • Capture interaction interfaces with plastocyanin through focused classification approaches

  • X-ray crystallography refinements:

    • Obtain atomic-resolution structures of barley Apocytochrome f under different redox states

    • Co-crystallize with interaction partners to visualize binding interfaces

    • Apply serial crystallography at X-ray free electron lasers (XFELs) for capturing transient states

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Map dynamic regions through hydrogen-deuterium exchange

    • Determine solution structures of flexible domains not resolved in crystal structures

    • Investigate redox-dependent conformational changes through chemical shift analysis

  • Integrative structural biology:

    • Combine multiple techniques (cryo-EM, crystallography, NMR, SAXS) for complete structural models

    • Implement cross-linking mass spectrometry to identify interaction surfaces

    • Utilize computational modeling to fill gaps in experimental structures

  • In situ structural approaches:

    • Apply cryo-electron tomography to visualize cytochrome b6f in native thylakoid membranes

    • Implement correlative light and electron microscopy to connect structure with function

    • Develop genetic tags for visualization in living cells without disrupting function

These advanced structural approaches would significantly enhance our understanding of species-specific features of barley Apocytochrome f and provide a foundation for rational engineering efforts aimed at improving photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.