Recombinant Hordeum vulgare ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Role in ATP Synthase

The atpI gene encodes the subunit a of the Fo sector, which forms the proton channel in the chloroplast ATP synthase complex. This subunit interacts with other Fo subunits (e.g., b, c) to create a transmembrane proton pathway, enabling proton gradient-driven ATP synthesis in the F1 sector .

Functional Studies

  • Proton Translocation: Subunit a is essential for forming the proton channel, as demonstrated by its role in stabilizing the Fo-F1 interaction and enabling ATP synthesis .

  • Redox Regulation: Chloroplast ATP synthase activity is modulated by redox states, with oxidized forms showing reduced ATP synthesis efficiency . Recombinant atpI could aid in studying these regulatory mechanisms.

Expression and Purification

  • Host Systems: Recombinant atpI is typically expressed in E. coli or yeast, with yields influenced by codon optimization and culture conditions .

  • Purification: The N-terminal His-tag allows affinity chromatography, yielding >85% pure protein .

Functional Assays

  • Proton Pumping: Incorporation of recombinant atpI into lipid vesicles or proteoliposomes enables measurement of proton translocation rates .

  • ATP Synthase Assembly: Studies in alkaliphilic Bacillus species suggest that homologs of atpI may stabilize the Fo-F1 complex, though this function is not universally essential .

Comparative Analysis with Other Organisms

OrganismSubunit a RoleKey Differences
Hordeum vulgareChloroplast ATP synthase proton channelFull-length expression in E. coli
Bacillus spp.Stabilizes Fo-F1 interactionsAtpI enhances enzyme stability
Triticum aestivumMitochondrial ATP synthase subunit αRNA editing modifies proton channel activity

Challenges and Future Directions

  • Partial Editing: Barley mitochondrial ATP synthase subunit atp9 undergoes RNA editing, though atpI (chloroplastic) lacks such modifications .

  • Regulatory Mechanisms: Interactions with 14-3-3 proteins, which modulate ATP synthase activity in plants, remain understudied for chloroplast atpI .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which serves as a reference for your convenience.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVVIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Hordeum vulgare ATP synthase subunit a, chloroplastic (atpI) and what is its primary function?

ATP synthase subunit a, chloroplastic (atpI) from Hordeum vulgare (barley) is a nucleus-encoded protein that functions as an essential component of the ATP synthase complex located in chloroplasts. It is specifically part of the membrane-embedded F₀ sector of the ATP synthase complex. The protein consists of 247 amino acids and contains a predicted transmembrane domain in its carboxyl-terminus that is conserved throughout the higher plant kingdom .

The primary function of this protein is to participate in the proton channel formation within the ATP synthase complex, facilitating the flow of protons across the thylakoid membrane. This proton flow drives the rotational catalysis of the ATP synthase, which is crucial for ATP production during photosynthesis. The protein helps convert the electrochemical gradient generated by photosynthetic electron transport into chemical energy in the form of ATP .

What methods are used for extracting and purifying recombinant atpI protein?

Standard protocols for extraction and purification of recombinant Hordeum vulgare ATP synthase subunit a include:

  • Expression system selection: E. coli is commonly used for expression of recombinant atpI, as seen with similar proteins like the Acorus americanus ATP synthase subunit a . This system allows for His-tagging of the protein for easier purification.

  • Optimization of expression conditions:

    • IPTG concentration: Typically 0.1-1.0 mM

    • Induction temperature: 15-30°C (lower temperatures may increase solubility)

    • Induction time: 4-16 hours

    • Growth media composition: LB or TB media supplemented with appropriate antibiotics

  • Cell lysis methods:

    • Sonication in buffer containing mild detergents

    • French press or high-pressure homogenization

    • Enzymatic lysis with lysozyme

  • Purification techniques:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography if needed

  • Buffer optimization:

    • Tris-based buffers (pH 7.5-8.0) containing 50% glycerol for stability

    • Addition of mild detergents to maintain protein solubility

    • Inclusion of protease inhibitors to prevent degradation

The final purified protein should reach >90% purity as determined by SDS-PAGE analysis .

For long-term storage, the protein is typically stored at -20°C to -80°C in a buffer containing 50% glycerol, with recommendations to avoid repeated freeze-thaw cycles .

What experimental approaches can be used to study the interaction between atpI and other ATP synthase subunits?

Several complementary experimental approaches can be employed to investigate the interaction between atpI and other ATP synthase subunits:

In vitro interaction assays:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpI or other subunits to pull down protein complexes, followed by western blot analysis to detect interacting partners.

  • Pull-down assays: Utilizing recombinant His-tagged atpI protein as bait to capture interacting proteins from chloroplast extracts.

  • Surface Plasmon Resonance (SPR): For determining binding kinetics and affinity constants between atpI and potential interaction partners.

  • Isothermal Titration Calorimetry (ITC): To measure thermodynamic parameters of protein-protein interactions.

In vivo interaction analysis:

  • Yeast two-hybrid (Y2H) assays: As demonstrated in research with other proteins, Y2H can verify protein-protein interactions in living cells . The approach involves:

    • Cloning atpI and potential interacting partners into bait and prey vectors

    • Co-transforming into yeast cells

    • Selecting for reporter gene activation indicating positive interactions

  • Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in plant cells, as has been demonstrated with other chloroplast proteins .

    • Split fluorescent protein fragments are fused to atpI and potential interacting partners

    • Reconstitution of fluorescence occurs only when the proteins interact

    • Localization of the interaction can be observed using confocal microscopy

  • Förster Resonance Energy Transfer (FRET): For detecting proximity between fluorescently labeled proteins in living cells.

Structural studies:

  • Crosslinking coupled with mass spectrometry: To map specific interaction domains.

  • Cryo-electron microscopy: For visualizing the structure of the entire ATP synthase complex and defining the position of atpI.

Research with rice has demonstrated that nucleus-encoded factors like YL1 can interact with core ATP synthase subunits (such as AtpB), suggesting similar auxiliary factors may exist for atpI in barley . These methods could reveal important insights into how atpI integrates into the ATP synthase complex and interacts with both core subunits and auxiliary factors.

How does atpI function compare between chloroplastic and mitochondrial ATP synthases in barley?

The comparison between chloroplastic atpI and its mitochondrial counterparts in barley reveals significant insights into organelle-specific adaptations of ATP synthases:

Structural comparison:

FeatureChloroplastic atpIMitochondrial ATP9 (Related subunit)
Genomic originNuclear-encoded Mitochondrial DNA-encoded
Copy numberSingle copyTwo copies in barley mitochondria
Transcript sizeNot specified in search resultsMajor transcripts of 2.7 kb and 1.2 kb
RNA editingNot reportedC-to-U conversion at seven positions
Post-translational processingImport into chloroplastsRNA editing affecting amino acid composition

Functional differences:

  • Direction of ATP synthesis:

    • Chloroplastic atpI: Functions in ATP synthesis during photosynthesis (light-dependent)

    • Mitochondrial ATP9: Functions in ATP synthesis during cellular respiration (light-independent)

  • Energy source:

    • Chloroplastic atpI: Utilizes proton gradient generated by photosynthetic electron transport

    • Mitochondrial ATP9: Utilizes proton gradient generated by respiratory electron transport

  • Regulatory mechanisms:

    • Chloroplastic atpI: Regulated by light conditions and photosynthetic activity

    • Mitochondrial ATP9: Regulated by metabolic demands and respiratory substrates

  • RNA editing impact:

    • In barley mitochondrial ATP9, RNA editing occurs at seven positions, with five leading to amino acid changes and two being silent modifications

    • This editing process affects approximately 24% of barley cDNA clones compared to 10% in wheat

    • These differences may contribute to species-specific adaptations

Methodological approaches for comparison:

  • Comparative genomic analysis of nuclear and organellar genes

  • Transcriptome profiling under different conditions

  • Import assays to study protein targeting

  • Activity assays under various substrate and inhibitor conditions

  • Structural modeling to identify organelle-specific adaptations

Understanding these differences is crucial for comprehending how ATP synthase complexes have adapted to function in distinct organellar environments while maintaining their core ATP synthesis capability.

What are the implications of studying atpI for understanding photosynthetic efficiency in crop plants?

Research on ATP synthase subunit a, chloroplastic (atpI) has significant implications for understanding and potentially enhancing photosynthetic efficiency in economically important crops like barley:

Fundamental contributions to photosynthetic efficiency:

  • Energy conversion optimization: ATP synthase represents a critical control point in photosynthetic energy conversion. Understanding atpI structure and function can reveal rate-limiting steps in the ATP production process that might be targeted for improvement.

  • Stress adaptation mechanisms: Research suggests that alterations in ATP synthase composition and activity may represent important adaptation strategies under environmental stress conditions, which increasingly threaten crop productivity.

  • Evolutionary conservation insights: Comparative studies of atpI between species (like barley and rice) reveal highly conserved domains essential for function, as well as species-specific adaptations that may contribute to differential photosynthetic performance .

Applied research directions:

  • Bioengineering targets: Modification of atpI or its regulatory factors could potentially:

    • Increase ATP production rate

    • Improve ATP synthase stability under stress conditions

    • Optimize proton/ATP ratios for greater energy efficiency

  • Marker-assisted selection: Identifying natural variants of atpI with enhanced properties could provide genetic markers for breeding programs targeting improved photosynthetic efficiency.

  • Diagnostic tools: Understanding the relationship between atpI and photosynthetic performance could lead to the development of molecular or biochemical markers to assess crop photosynthetic potential.

Evidence from related research shows that auxiliary factors like YL1 in rice play crucial roles in the biogenesis and efficient functioning of chloroplast ATP synthase . Studies have shown that mutants deficient in such factors exhibit reduced chlorophyll content, abnormal chloroplast morphology, and decreased photochemical efficiency . Similar mechanisms likely exist in barley, suggesting multiple potential targets for enhancing ATP synthase function.

The potential impact of such research extends beyond basic science to address global challenges in food security by contributing to the development of crop varieties with improved photosynthetic efficiency, particularly under challenging environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.