Recombinant Hordeum vulgare ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
atpF
Target Protein Sequence
MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYSEIEREKANLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGSLE WKR
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the fundamental function of ATP synthase subunit b in barley chloroplasts?

ATP synthase subunit b (atpF) is a critical component of the F₀ sector of the ATP synthase complex in barley chloroplasts. It contributes to the structural integrity of the F₀ portion and facilitates proton translocation across the thylakoid membrane. The F₀ sector works in concert with the F₁ sector to convert the electrochemical gradient of protons (ΔμH⁺) into mechanical energy that drives ATP synthesis from ADP and inorganic phosphate (Pi) . The subunit b helps anchor the F₁ catalytic portion to the membrane-embedded F₀ portion, enabling the rotational mechanism essential for efficient ATP production during photosynthesis.

How does the structure of chloroplastic ATP synthase subunit b differ from its mitochondrial counterpart?

While both chloroplastic and mitochondrial ATP synthases operate via similar rotational mechanisms, their subunit b components display key structural differences. The chloroplastic ATP synthase subunit b in Hordeum vulgare contains specific domains optimized for function within the thylakoid membrane environment, whereas mitochondrial ATP synthase operates in the inner mitochondrial membrane . The chloroplastic variant has evolved distinct amino acid sequences that facilitate interactions with other chloroplast-specific subunits while maintaining the core function of participating in proton translocation. Unlike the mitochondrial counterpart that may participate in processes like mitochondrial permeability transition pore formation, the chloroplastic subunit b is specialized for photosynthetic energy conversion.

What are the conserved domains in Hordeum vulgare ATP synthase subunit b that are critical for its function?

The Hordeum vulgare ATP synthase subunit b contains several highly conserved domains that are essential for its functionality. These include transmembrane regions that anchor the protein within the thylakoid membrane, hydrophilic domains that interact with the α and β subunits of the F₁ sector, and specific binding sites that facilitate assembly of the complete ATP synthase complex . The protein also contains regions that participate in the coupling of proton movement to the rotational mechanism of ATP synthesis. Sequence analysis reveals high conservation of these functional domains across various plant species, indicating their evolutionary importance in maintaining the efficient operation of chloroplastic ATP synthesis.

What are the advantages and limitations of different expression systems for producing recombinant Hordeum vulgare atpF protein?

Multiple expression systems can be employed for producing recombinant Hordeum vulgare ATP synthase subunit b, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, low cost, established protocolsLimited post-translational modifications, potential inclusion body formationInitial characterization, antibody production, structural studies
YeastEukaryotic processing, moderate yield, secretion possibleLonger production time than E. coli, hyperglycosylationFunctional studies requiring some PTMs
BaculovirusComplex PTMs, high protein folding fidelity, high yieldTime-consuming, technically demanding, higher costStudies requiring authentic protein folding and activity
Mammalian cellsMost authentic PTMs, proper protein foldingLowest yield, highest cost, complex methodologyInteraction studies requiring native-like protein properties

Selection should be based on research needs, with E. coli systems (CSB-EP373947HWQ1) preferable for structural studies, while mammalian expression (CSB-MP373947HWQ1) may be necessary when authentic post-translational modifications are critical .

What methodological approaches can improve the solubility of recombinant atpF protein when expressed in E. coli?

Improving solubility of recombinant Hordeum vulgare ATP synthase subunit b in E. coli requires multiple optimization strategies:

  • Temperature modification: Lowering expression temperature to 16-20°C slows protein synthesis, allowing more time for proper folding and reducing inclusion body formation.

  • Co-expression with chaperones: Introducing molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE can assist in proper protein folding.

  • Solubility tags optimization: Utilizing solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin. The selection of appropriate tags is crucial, as indicated by the product specification "Tag type will be determined during the manufacturing process" .

  • Media and induction optimization: Using enriched media (such as Terrific Broth) and optimizing IPTG concentration (typically 0.1-0.5 mM) and induction time.

  • Lysis buffer formulation: Developing specialized buffers containing mild detergents (0.1-1% Triton X-100), higher salt concentrations (300-500 mM NaCl), and stabilizing agents like glycerol (5-10%) to maintain protein solubility during extraction.

These approaches should be systematically tested and combined as needed to achieve optimal solubility while maintaining protein functionality.

How can in vivo biotinylation enhance the utility of recombinant atpF protein for interaction studies?

In vivo biotinylation substantially enhances recombinant atpF protein utility for interaction studies through several mechanisms:

The AviTag-BirA technology enables site-specific biotinylation of the recombinant protein during expression in E. coli (CSB-EP373947HWQ1-B) . This process involves the E. coli biotin ligase (BirA) catalyzing an amide linkage between biotin and a specific lysine residue within the 15-amino acid AviTag peptide fused to the atpF protein.

This approach provides significant advantages for interaction studies:

  • Orientation-specific immobilization: The biotin tag allows for controlled, oriented attachment to streptavidin-coated surfaces, ensuring that protein interaction domains remain accessible.

  • High-sensitivity detection: The exceptional biotin-streptavidin affinity (Kd ≈ 10⁻¹⁵ M) enables detection of even weak protein-protein interactions that might occur between ATP synthase subunit b and other photosynthetic complexes.

  • Compatibility with advanced techniques: Biotinylated atpF protein can be directly employed in surface plasmon resonance (SPR), bio-layer interferometry, and pull-down assays without additional modification steps.

  • Quantitative binding studies: The 1:1 stoichiometry of biotinylation allows for precise determination of binding kinetics and affinity constants when studying interactions with other chloroplast proteins.

This technology has proven particularly valuable for studying interactions between ATP synthase components and other factors that may regulate its assembly or activity.

What assays can be used to evaluate the functional integrity of recombinant atpF protein?

Multiple complementary assays can verify the functional integrity of recombinant Hordeum vulgare ATP synthase subunit b:

  • Binding assays with partner subunits: Co-immunoprecipitation or pull-down assays using recombinant atpF and other ATP synthase subunits (particularly α and β subunits) can confirm the protein's ability to form proper subunit interactions . Successful binding indicates maintenance of native conformational properties.

  • Reconstitution experiments: Incorporation of purified recombinant atpF into liposomes or nanodiscs alongside other ATP synthase components, followed by measurement of proton translocation using pH-sensitive fluorescent dyes (such as ACMA or pyranine).

  • Circular dichroism spectroscopy: Analysis of secondary structure content compared to native protein isolated from barley chloroplasts. The recombinant protein should display similar α-helical content to the native form.

  • Limited proteolysis: Controlled digestion with proteases followed by comparison of fragmentation patterns between recombinant and native proteins. Similar digestion patterns indicate proper folding.

  • ATP hydrolysis coupling assay: While subunit b itself doesn't possess catalytic activity, its proper function can be assessed by measuring ATP hydrolysis rates in reconstituted complexes with and without the recombinant protein.

These assays collectively provide a comprehensive assessment of whether the recombinant protein maintains the structural and functional properties necessary for its role in the ATP synthase complex.

How can researchers differentiate between properly folded and misfolded recombinant atpF protein?

Distinguishing properly folded from misfolded recombinant Hordeum vulgare ATP synthase subunit b requires multiple analytical approaches:

  • Size exclusion chromatography (SEC): Properly folded protein typically elutes as a defined peak corresponding to the expected molecular weight, while misfolded variants often form aggregates that elute in the void volume. The SEC profile should be compared with that of native protein or well-characterized standards.

  • Intrinsic fluorescence spectroscopy: Changes in the local environment of tryptophan residues between properly folded and misfolded states result in shifts in emission maxima. Properly folded atpF typically exhibits a blue-shifted emission maximum compared to misfolded variants.

  • Differential scanning calorimetry (DSC): Thermal denaturation profiles reveal cooperative unfolding transitions in properly folded proteins, whereas misfolded variants show irregular or absent thermal transitions.

  • Limited proteolysis: Properly folded proteins display distinct, reproducible digestion patterns when subjected to limited proteolysis, while misfolded variants typically show more rapid and less specific degradation patterns.

  • Binding activity assays: Interaction with known binding partners, such as the α and β subunits of ATP synthase , can be quantitatively assessed. Properly folded protein will maintain near-native binding affinities and kinetics.

  • ANS binding: The fluorescent dye 8-anilino-1-naphthalenesulfonic acid (ANS) exhibits increased fluorescence when bound to exposed hydrophobic regions, which are more prevalent in misfolded proteins.

Implementing multiple orthogonal methods provides the most reliable assessment of protein folding status.

What are the critical buffer conditions for maintaining stability of purified recombinant atpF protein?

Maintaining stability of purified recombinant Hordeum vulgare ATP synthase subunit b requires careful optimization of buffer conditions:

  • pH optimization: The protein typically exhibits maximum stability between pH 7.0-8.0, with phosphate or Tris-based buffers at 20-50 mM concentration providing good buffering capacity without interfering with protein integrity.

  • Salt concentration: Including 150-300 mM NaCl or KCl helps prevent non-specific aggregation and mimics physiological ionic strength. Higher salt concentrations (up to 500 mM) may be necessary if the protein shows aggregation tendencies.

  • Stabilizing additives: Addition of 5-10% glycerol significantly enhances long-term stability by preventing aggregation and protecting against freeze-thaw damage . Other potentially beneficial additives include:

    • 1-5 mM DTT or 0.5-2 mM TCEP to maintain reduced states of cysteine residues

    • 0.5-1 mM EDTA to chelate metal ions that could catalyze oxidation

    • 0.02-0.05% non-ionic detergents (e.g., DDM or Triton X-100) to mimic membrane environment

  • Storage conditions: For lyophilized protein (as provided in product form) , reconstitution should be performed in deionized sterile water to 0.1-1.0 mg/mL, with addition of 5-50% glycerol recommended for storage.

  • Temperature considerations: Store at -80°C for long-term stability, with minimal freeze-thaw cycles. For working stocks, 4°C storage is suitable for 1-2 weeks with proper buffer optimization.

These buffer conditions should be experimentally optimized for each specific application, as requirements may vary depending on downstream use of the protein.

How can recombinant atpF be used to study assembly mechanisms of the chloroplastic ATP synthase complex?

Recombinant Hordeum vulgare ATP synthase subunit b provides powerful tools for dissecting chloroplastic ATP synthase assembly mechanisms:

  • Fluorescently labeled subunit tracking: Recombinant atpF tagged with fluorescent proteins can be used in chloroplast import assays to visualize and track the temporal and spatial aspects of subunit incorporation into developing ATP synthase complexes.

  • Domain mapping with truncation mutants: Systematic creation of truncated atpF variants allows identification of specific domains essential for interactions with other ATP synthase components. This approach has successfully identified regions critical for F₀-F₁ association in similar ATP synthase systems .

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking of recombinant atpF with other ATP synthase subunits, followed by mass spectrometric analysis, reveals precise interaction interfaces and assembly intermediates.

  • In vitro reconstitution assays: Step-wise addition of purified recombinant ATP synthase components, including atpF, can recapitulate the assembly process in controlled conditions, allowing identification of assembly factors and rate-limiting steps.

  • Competition assays: Using recombinant atpF variants to compete with endogenous protein during chloroplast development can disrupt normal assembly, revealing stage-specific assembly checkpoints.

These approaches collectively provide mechanistic insights into how the multi-subunit ATP synthase complex assembles in chloroplasts, which remains less well understood than the assembly of mitochondrial ATP synthase complexes .

What insights can comparative studies between recombinant chloroplastic and mitochondrial ATP synthase subunit b provide?

Comparative studies between recombinant chloroplastic atpF from Hordeum vulgare and mitochondrial ATP synthase subunit b offer valuable evolutionary and functional insights:

  • Structural adaptations: Detailed structural comparison reveals adaptations specific to each cellular compartment. While both participate in ATP synthase complexes, the chloroplastic variant has evolved features optimized for the thylakoid membrane environment, whereas the mitochondrial counterpart contains elements that potentially contribute to additional functions such as participation in the mitochondrial permeability transition pore (mPTP) .

  • Regulatory differences: Studies comparing post-translational modifications between the two variants reveal distinct regulatory mechanisms. Mitochondrial ATP synthase regulation involves specific interactions with proteins like cyclophilin D (CypD) , while chloroplastic ATP synthase is regulated through mechanisms adapted to photosynthetic needs.

  • Evolutionary conservation analysis: Sequence alignment and structural comparison between chloroplastic and mitochondrial variants across species provides evidence for evolutionary divergence from a common ancestor, revealing conserved functional domains versus adaptations specific to each organelle.

  • Differential protein-protein interactions: Interactome studies using both recombinant proteins identify shared binding partners versus organelle-specific interactors, illuminating how each variant integrates into its respective cellular machinery.

  • Functional reconstitution comparison: Side-by-side reconstitution experiments comparing proton translocation efficiency, ATP synthesis rates, and responses to inhibitors reveal fundamental similarities in core mechanisms but differences in regulatory properties.

These comparative approaches highlight how similar protein components have evolved specialized properties while maintaining core functionality across different cellular compartments.

How can site-directed mutagenesis of recombinant atpF be used to investigate proton translocation mechanisms?

Site-directed mutagenesis of recombinant Hordeum vulgare ATP synthase subunit b provides a powerful approach to dissect proton translocation mechanisms:

  • Transmembrane domain mutations: Systematic modification of residues within the membrane-spanning regions can identify amino acids critical for proton channel formation. Mutations targeting conserved charged or polar residues are particularly informative, as these often participate directly in proton transfer pathways.

  • Interface residue modifications: Altering amino acids at the interface between subunit b and other F₀ components (particularly a and c subunits) can reveal how subunit interactions contribute to maintaining the integrity of the proton translocation pathway. These studies can clarify how conformational changes in one subunit are transmitted to others during the rotational catalysis.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions throughout atpF allows for site-directed labeling with environmental probes or cross-linking agents. This approach provides detailed information about accessibility, proximity relationships, and conformational changes during the catalytic cycle.

  • Charge-altering mutations: Systematic neutralization or charge reversal of key residues can identify those involved in establishing the local electrostatic environment that facilitates proton movement. The comparison of the effect of these mutations between chloroplastic and mitochondrial ATP synthases reveals organelle-specific adaptations in proton handling.

  • Combination with spectroscopic techniques: Introducing spectroscopically active amino acids (e.g., tryptophan) at strategic positions enables real-time monitoring of conformational changes during proton translocation using fluorescence spectroscopy.

By correlating structural alterations with functional outcomes, these mutagenesis approaches provide mechanistic insights into how ATP synthase coordinates proton movement with rotational catalysis to drive ATP synthesis .

What are common challenges in obtaining high purity recombinant atpF protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying recombinant Hordeum vulgare ATP synthase subunit b, each requiring specific solutions:

  • Co-purification of bacterial chaperones: E. coli chaperones (particularly GroEL) often co-purify with recombinant membrane proteins like atpF.

    • Solution: Include ATP (5-10 mM) and MgCl₂ (5 mM) in wash buffers to promote chaperone release. Additional wash steps with mild denaturants (0.5-1M urea) can remove persistently bound chaperones without denaturing the target protein.

  • Aggregation during concentration: atpF protein often aggregates during concentration steps required for structural studies.

    • Solution: Maintain protein concentration below 2 mg/mL during purification. Add stabilizers like 5-10% glycerol and 0.05-0.1% mild detergents (DDM or LDAO) to prevent aggregation. Concentrate in smaller increments with gentle mixing between steps.

  • Proteolytic degradation: Membrane proteins are often susceptible to degradation during extended purification processes.

    • Solution: Maintain samples at 4°C throughout purification. Include protease inhibitor cocktails in all buffers. Consider using E. coli strains lacking key proteases (like BL21(DE3) pLysS). Minimize purification time by optimizing protocols.

  • Endotoxin contamination: Critical for applications involving immunological studies.

    • Solution: Implement Triton X-114 phase separation or polymyxin B affinity steps. Commercial endotoxin removal resins can reduce endotoxin levels to <0.1 EU/mg protein.

  • Heterogeneous protein preparation: Multiple conformational states can complicate structural and functional studies.

    • Solution: Employ size-exclusion chromatography as a final polishing step. Consider using more specialized techniques like sucrose gradient ultracentrifugation to separate different oligomeric states.

Implementing these specialized approaches can significantly improve the quality of purified recombinant atpF protein, ensuring it meets the >85% purity standard typically required for functional studies .

How can researchers verify successful incorporation of recombinant atpF into liposomal membranes for functional studies?

Verifying successful incorporation of recombinant Hordeum vulgare ATP synthase subunit b into liposomal membranes requires multiple complementary approaches:

  • Density gradient centrifugation analysis: Properly reconstituted proteoliposomes containing atpF will migrate to a characteristic density interface between free protein and empty liposomes. Quantitative analysis of protein distribution across gradient fractions provides a reliable measure of incorporation efficiency.

  • Freeze-fracture electron microscopy: This technique provides direct visualization of protein particles embedded within the lipid bilayer. The size distribution and density of particles can confirm successful incorporation and provide information about protein orientation and aggregation state.

  • Protease protection assays: Limited proteolysis of reconstituted proteoliposomes with and without membrane permeabilization (using detergents like Triton X-100) reveals which protein domains are protected by the lipid bilayer, confirming proper membrane insertion.

  • Fluorescence quenching experiments: Incorporating environment-sensitive fluorescent labels at specific positions in recombinant atpF allows monitoring of membrane insertion through changes in fluorescence intensity or emission maxima upon reconstitution.

  • Dynamic light scattering (DLS): Comparison of particle size distribution between empty liposomes and proteoliposomes provides evidence for protein incorporation, as successful reconstitution typically increases average particle diameter.

  • Functional assays: Measurement of ATP-dependent proton pumping using pH-sensitive fluorescent dyes (like ACMA) provides the most definitive evidence of functional incorporation.

These complementary approaches collectively provide comprehensive verification of successful reconstitution, essential for reliable interpretation of subsequent functional studies.

What are the key considerations when designing interaction studies between recombinant atpF and other chloroplast proteins?

Designing robust interaction studies between recombinant Hordeum vulgare ATP synthase subunit b and other chloroplast proteins requires careful attention to several critical parameters:

  • Membrane environment simulation: ATP synthase subunit b is naturally membrane-embedded, so interaction studies should incorporate:

    • Detergent micelles with carefully selected detergents (DDM, LDAO) that maintain native-like protein conformations

    • Nanodiscs or liposomes with lipid compositions mimicking the chloroplast thylakoid membrane (higher phosphatidylglycerol and monogalactosyldiacylglycerol content)

    • Proper protein orientation control using technologies like biotin-AviTag systems

  • Buffer optimization: Interaction conditions should reflect the chloroplast stroma environment:

    • pH 7.8-8.2 to mimic stromal pH during active photosynthesis

    • 100-150 mM potassium rather than sodium salts

    • 5-10 mM magnesium to maintain proper protein conformation

    • Inclusion of small molecules present in chloroplasts (ATP, ADP) that may modulate interactions

  • Detection method selection: Choose techniques appropriate for membrane protein interactions:

    • Microscale thermophoresis (MST) can detect interactions with minimal protein consumption

    • Bio-layer interferometry with streptavidin sensors works well with biotinylated atpF variants

    • Fluorescence resonance energy transfer (FRET) for studying interactions in a membrane environment

  • Controls and validation strategies:

    • Use known interaction partners (ATP synthase α/β subunits) as positive controls

    • Include unrelated membrane proteins as negative controls

    • Validate interactions through multiple orthogonal techniques

    • Perform competition assays with unlabeled proteins to confirm specificity

  • Protein tag considerations:

    • Position tags (His, GST, etc.) away from predicted interaction interfaces

    • Verify that tags don't interfere with interactions through comparison studies with tag-cleaved proteins

    • Consider native immunoprecipitation with anti-atpF antibodies as a complementary approach

Following these methodological guidelines ensures that detected interactions reflect physiologically relevant protein-protein associations rather than experimental artifacts.

How does Hordeum vulgare atpF compare structurally and functionally with homologs in other plant species?

Comparative analysis of Hordeum vulgare ATP synthase subunit b with homologs across plant species reveals important evolutionary patterns:

This comparative analysis provides insights into both the conserved core mechanisms of chloroplastic ATP synthesis and the specialized adaptations that have evolved in different plant lineages.

What experimental approaches can reveal the evolutionary history of chloroplastic ATP synthase subunit b?

Investigating the evolutionary history of chloroplastic ATP synthase subunit b requires integrating multiple experimental approaches:

These complementary approaches collectively provide a comprehensive view of how chloroplastic ATP synthase subunit b has evolved from its cyanobacterial origins to its present form in modern plant chloroplasts.

How do post-translational modifications of ATP synthase subunit b differ between species and what functional implications do these differences have?

Post-translational modifications (PTMs) of ATP synthase subunit b exhibit important species-specific patterns with significant functional implications:

  • Phosphorylation patterns: Mass spectrometry analysis reveals that phosphorylation sites on atpF vary between species:

    • Monocots like Hordeum vulgare typically contain 2-3 conserved phosphorylation sites in the stromal-facing domains

    • Dicotyledonous plants often display additional phosphorylation sites in regulatory regions

    • These phosphorylation differences likely reflect adaptations to different light harvesting strategies and energy needs

    Functional consequences include altered binding affinities with partner subunits and modified responses to regulatory signals during light/dark transitions.

  • Acetylation profiles: Acetylation of lysine residues in atpF shows significant variation across plant species:

    • Species adapted to high light conditions show increased acetylation at specific positions, potentially providing protection against oxidative damage

    • The pattern and stoichiometry of acetylation correlate with photosynthetic efficiency under different environmental conditions

    These modifications affect protein stability and interactions with regulatory proteins that modulate ATP synthase activity.

  • Redox-sensitive modifications: The number and positioning of cysteine residues capable of forming regulatory disulfide bonds varies between species:

    • C4 plants contain additional regulatory cysteines compared to C3 plants

    • These differences enable species-specific responses to changing redox conditions during photosynthesis

    The variations in redox sensitivity allow fine-tuning of ATP synthase activity in response to metabolic demands specific to each species' photosynthetic strategy.

  • N-terminal processing: The transit peptide cleavage sites and subsequent N-terminal modifications vary between species:

    • Differences in N-terminal processing affect protein stability and membrane insertion efficiency

    • Species-specific N-terminal modifications correlate with chloroplast ultrastructure variations

    These processing differences influence the rate and efficiency of ATP synthase assembly in different plant species.

These diverse PTM patterns represent evolutionary adaptations that fine-tune ATP synthase function to specific ecological niches and metabolic requirements across plant species, while maintaining the core catalytic functions of the complex.

What emerging technologies could advance our understanding of atpF structure and function in chloroplastic ATP synthesis?

Several cutting-edge technologies are poised to revolutionize our understanding of Hordeum vulgare ATP synthase subunit b structure and function:

  • Cryo-electron tomography: This technique can visualize ATP synthase complexes directly within the native membrane environment of chloroplast thylakoids, revealing how subunit b contributes to the supramolecular organization of ATP synthase dimers and oligomers. Recent advances in this methodology have already provided unprecedented insights into ATP synthase structure in mitochondria and could be applied to chloroplastic complexes.

  • Single-molecule FRET spectroscopy: By labeling specific sites on recombinant atpF and other ATP synthase components with fluorescent dyes, researchers can track real-time conformational changes during the catalytic cycle at unprecedented temporal resolution. This approach could reveal how subunit b participates in transmitting conformational changes between the F₀ and F₁ sectors.

  • Integrative structural biology: Combining multiple structural determination methods (X-ray crystallography, cryo-EM, NMR, mass spectrometry) with computational modeling can generate complete structural models of the entire ATP synthase complex, including accurate positioning of subunit b within the membrane environment.

  • Genome editing in chloroplasts: Recent advances in chloroplast genome editing using CRISPR-based technologies enable precise modification of the native atpF gene, allowing for in vivo structure-function studies through site-directed mutagenesis in the natural context.

  • Advanced molecular dynamics simulations: Increased computational power now allows simulation of entire ATP synthase complexes within realistic membrane environments for microsecond timescales, providing insights into how subunit b contributes to proton translocation and rotary mechanics.

  • Ultrafast AFM imaging: Recent developments in high-speed atomic force microscopy can capture conformational dynamics of membrane proteins at nanometer resolution and millisecond time scales, potentially revealing transient states in ATP synthase operation that involve subunit b.

These emerging technologies, particularly when applied in complementary fashion, promise to reveal new aspects of how atpF contributes to the structure, assembly, and function of chloroplastic ATP synthase.

What are the potential applications of recombinant atpF protein in synthetic biology and bioenergetics research?

Recombinant Hordeum vulgare ATP synthase subunit b holds significant potential for synthetic biology and bioenergetics applications:

  • Bio-inspired energy conversion systems: Incorporation of recombinant atpF into artificial membrane systems could help develop biomimetic energy-harvesting devices that convert proton gradients into usable energy. These systems could potentially address challenges in renewable energy storage and conversion by mimicking the highly efficient ATP synthase rotary mechanism .

  • Minimal synthetic chloroplasts: Reconstitution of simplified photosynthetic systems incorporating key components like ATP synthase subunit b represents a stepping stone toward creating minimal synthetic organelles. These systems could serve as platforms for studying fundamental bioenergetic principles and potentially for bioproduction of high-value compounds.

  • Protein-based molecular machines: The structural features of atpF that facilitate its role in the F₀ rotary mechanism could inspire design of novel protein-based molecular motors for nanoscale applications. Understanding the structure-function relationship in atpF could inform rational design of such molecular machines.

  • Biosensors for proton gradient detection: Modified recombinant atpF proteins incorporating environment-sensitive fluorescent probes could serve as sensitive detectors for proton gradients in biological and artificial systems. These biosensors could find applications in monitoring bioenergetic processes in live cells or in artificial photosynthetic systems.

  • Biomolecular scaffolds: The structural properties of atpF, particularly its membrane-spanning domains and ability to form stable interactions with partner proteins, make it a potential scaffold for developing novel membrane protein architectures in synthetic biology applications.

  • Educational models and research tools: Well-characterized recombinant atpF proteins could serve as components in research kits for studying membrane protein reconstitution, protein-protein interactions, and bioenergetic principles in educational and research settings.

These applications highlight how fundamental research on chloroplastic ATP synthase components can translate into innovative biotechnological applications that extend beyond basic science.

How might climate change adaptation research benefit from studies of ATP synthase variants across Hordeum vulgare cultivars?

Climate change adaptation research could gain valuable insights from studying ATP synthase subunit b variants across diverse Hordeum vulgare cultivars:

  • Heat stress tolerance mechanisms: Comparing atpF sequences and post-translational modifications between heat-tolerant and heat-sensitive barley cultivars can reveal adaptive variations that maintain ATP synthase function under elevated temperatures. These insights could guide breeding programs targeting improved thermotolerance in crops, as ATP synthesis is often compromised during heat stress.

  • Drought adaptation strategies: Certain barley cultivars from arid regions contain specific adaptations in ATP synthase components that maintain energy production under water-limited conditions. Identifying these adaptive traits in atpF could inform development of drought-resistant varieties through targeted breeding or genetic engineering approaches.

  • Photosynthetic efficiency under changing CO₂ levels: Variations in ATP synthase regulation across cultivars may correlate with differences in photosynthetic efficiency under elevated CO₂. Studying how different atpF variants respond to changing carbon dioxide levels could help identify genotypes better adapted to future atmospheric conditions.

  • Salinity stress resistance: Barley cultivars with enhanced tolerance to soil salinity often show modifications in chloroplast bioenergetics. Characterizing atpF variations in salt-tolerant cultivars could reveal mechanisms that maintain efficient ATP production under ionic stress.

  • Genetic resources for crop improvement: Creating a comprehensive catalog of natural atpF variants across wild and cultivated Hordeum vulgare could provide valuable genetic resources for crop improvement. This approach aligns with techniques used in barley genetic mapping studies , where identifying beneficial alleles has proven valuable for crop improvement.

  • Predictive modeling for climate adaptation: Correlating specific atpF sequence variations with environmental parameters across the geographic range of barley could enable development of predictive models for identifying optimal genotypes for future climate scenarios.

By connecting molecular variations in this critical bioenergetic component to whole-plant performance under changing environmental conditions, researchers can develop more targeted approaches to enhancing crop resilience in the face of climate change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.