Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic (LHC Ib-20)

Shipped with Ice Packs

In Stock

Cat. No.

BT2454430

Source

in vitro E.coli expression system

Synonyms

LHC; Ib-20; Chlorophyll a-b binding protein 1B-20, chloroplastic; LHCI type I CAB-1B-20; Light-harvesting complex I 20 kDa protein; Fragment

Quick Inquiry

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time

Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.

Shelf Life

Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms

LHC; Ib-20; Chlorophyll a-b binding protein 1B-20, chloroplastic; LHCI type I CAB-1B-20; Light-harvesting complex I 20 kDa protein; Fragment

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

32-231

Protein Length

Full Length of Mature Protein

Species

Hordeum vulgare (Barley)

Target Names

LHC

Target Protein Sequence

AKGSWLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLI PEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQDPI FKSYSLPPHECGYPGRVFNPLNFAPLENKEKELANGRLAMLAFLGFLVQHNVHGKGPFEN LQQHLADPWHNTIIQTISGQ

Uniprot No.

Q36718

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families

Light-harvesting chlorophyll a/b-binding (LHC) protein family

Subcellular Location

Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the primary function of LHC Ib-20 in Hordeum vulgare?

LHC Ib-20 functions as an antenna protein in the light-harvesting complex of photosystem II (PSII), facilitating energy transfer from chlorophyll and xanthophylls to the reaction center . It is structurally conserved across photosynthetic eukaryotes, with sequence homology enabling cross-reactivity with antibodies targeting homologs in Arabidopsis, Chlamydomonas, and other species .

How is LHC Ib-20 expressed and regulated?

Expression of LHC Ib-20 is light-dependent and modulated by abscisic acid (ABA). Physiological ABA levels enhance LHC Ib-20 gene expression, while stress-induced ABA accumulation fine-tunes its transcription through WRKY40, a transcriptional repressor .

What methods are available for detecting LHC Ib-20?

Method	Application	Sensitivity	Key Considerations
ELISA	Quantitative protein analysis	High	Requires recombinant protein standards
Western blotting	Protein confirmation	Moderate	Polyclonal antibodies recommended
Immunoprecipitation	Complex isolation	Low	Requires affinity-purified antibodies

How to resolve contradictions in ABA-mediated LHC Ib-20 regulation?

Studies show dual roles for ABA: low concentrations enhance LHC Ib-20 expression, while high stress-induced ABA levels may suppress it via WRKY40 . To address this:

Experimental Design: Use wrky40 mutants to isolate ABA’s direct effects from indirect WRKY40-mediated repression.
Data Analysis: Quantify ABA levels and WRKY40 expression alongside LHC Ib-20 transcripts to disentangle pathways.

What approaches optimize recombinant LHC Ib-20 production?

Parameter	Recommendation	Rationale
Expression host	E. coli (for cost-efficiency) or insect cells (for post-translational modifications)	E. coli avoids glycosylation, critical for antibody compatibility
Purification method	Nickel-affinity chromatography (His-tagged proteins)	Ensures high purity for ELISA/Western blot
Storage conditions	-20°C in Tris-based buffer with 50% glycerol	Prevents aggregation and degradation

How to validate LHC Ib-20’s role in stress adaptation?

Hypothetical Testing:
- Null Mutant Analysis: Compare LHC Ib-20-knockout barley with wild-type under drought or high-light stress.
- ABA Application: Treat plants with exogenous ABA and monitor LHC Ib-20 expression via qRT-PCR or immunoblotting .
Data Interpretation:
- Physiological Metrics: Measure photosynthetic efficiency (e.g., Fv/Fm ratios) and ABA accumulation.
- Transcriptomics: Profile WRKY40 and ABA-responsive genes to map regulatory networks .

How to address antibody specificity in cross-species studies?

Strategy	Implementation	Validation
Peptide Blocking	Pre-incubate antibody with immunizing peptide to confirm epitope specificity	Western blot with/without blocking peptide
Ortholog Comparison	Align LHC Ib-20 sequences from Hordeum, Arabidopsis, and other species to identify conserved regions	BLAST or ClustalW analysis
Immunoprecipitation	Co-IP with known PSII subunits (e.g., D1/D2) to confirm complex association	Mass spectrometry of pulled-down proteins

What are key considerations for studying LHC Ib-20 in ABA signaling?

Temporal Dynamics: ABA effects on LHC Ib-20 are dose- and time-dependent. Use short-term (0–24 hr) treatments for activation studies and longer exposures (48+ hr) for repression analysis .
Light Interactions: Conduct experiments under controlled light conditions, as light modulates ABA-LHCB cross-talk .

How to integrate LHC Ib-20 into systems biology models?

Network Mapping:
- Co-expression Analysis: Identify genes co-regulated with LHC Ib-20 under stress (e.g., WRKY40, ABI5) .
- ChIP-Seq: Confirm WRKY40 binding to LHC Ib-20 promoters in vivo .
Synthetic Biology: Engineer LHC Ib-20 variants with altered ABA responsiveness to probe signaling thresholds.

What are unresolved questions in LHC Ib-20 research?

Mechanistic Uncertainties:
- Direct vs. Indirect ABA Effects: Does ABA directly bind LHC Ib-20, or act via transcription factors?
- Post-Translational Modifications: Role of phosphorylation or ubiquitination in protein stability/stress response.
Ecological Relevance:
- Field Stress Models: Translate controlled-environment findings to natural drought/high-light conditions.

Recommended Antibodies for LHC Ib-20 Detection

Antibody Type	Source	Reactivity	Applications
Polyclonal	Agrisera AS01 003	Hordeum vulgare, Arabidopsis, Chlamydomonas	Western blot, IP, ImmunoGold
Monoclonal	Custom synthesis	Hordeum vulgare (sequence-specific)	High-specificity ELISA

Recombinant Protein Specifications (ELISA Kit)

Parameter	Value	Source
Protein length	Full-length (45–245 AA)
Tag	Determined during production (e.g., His-tag, GST)
Purity	≥95% (SDS-PAGE confirmed)
Storage buffer	Tris-based, 50% glycerol, pH 7.4

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic (LHC Ib-20)

Product Specs

Target Background

Q&A

What is the primary function of LHC Ib-20 in Hordeum vulgare?

How is LHC Ib-20 expressed and regulated?

What methods are available for detecting LHC Ib-20?

How to resolve contradictions in ABA-mediated LHC Ib-20 regulation?

What approaches optimize recombinant LHC Ib-20 production?

How to validate LHC Ib-20’s role in stress adaptation?

How to address antibody specificity in cross-species studies?

What are key considerations for studying LHC Ib-20 in ABA signaling?

How to integrate LHC Ib-20 into systems biology models?

What are unresolved questions in LHC Ib-20 research?

Recommended Antibodies for LHC Ib-20 Detection

Recombinant Protein Specifications (ELISA Kit)

Quick Inquiry

Category

Service