Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic (LHC Ib-21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LHC; Ib-21; LHCA1; Chlorophyll a-b binding protein 1B-21, chloroplastic; LHCI type I CAB-1B-21; LHCI-730 chlorophyll a/b binding protein; Light-harvesting complex I 21 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-245
Protein Length
Full Length of Mature Protein
Species
Hordeum vulgare (Barley)
Target Names
LHC
Target Protein Sequence
SAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVP EALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEK KKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATH LADPWHNNIGDIVIPRNIYGP
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

UniGene: Hv.3889

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Chlorophyll a-b binding protein 1B-21 in barley?

LHC Ib-21 primarily functions as a light-harvesting protein that collects and transfers light energy to photosynthetic reaction centers. It belongs to the LHCI family (associated with Photosystem I) and plays a crucial role in the structure, function, and regulation of the light-harvesting antenna systems in barley chloroplasts . The protein contains specific binding sites for chlorophyll molecules (both chlorophyll a and b) and functions in the external antenna complex of Photosystem I, facilitating efficient capture and transfer of light energy during photosynthesis .

How many LHC genes are present in the barley genome and how are they organized?

A genome-wide analysis identified 17 non-redundant LHC genes (HvLHCs) in the barley genome. These genes vary in length, with genomic sequences ranging from 780 bp to 2779 bp and ORF sequences from 738 bp to 933 bp . The barley LHC gene family can be divided into multiple subfamilies based on phylogenetic analysis, with LHC Ib-21 belonging to the LHCI subfamily. Comparative genomic analysis with rice and Arabidopsis revealed that while most LHC genes are common across these species, some are specific to either Arabidopsis or the Poaceae family (which includes barley) .

How is the expression of LHC Ib-21 regulated in response to environmental factors?

LHC gene expression is regulated by both developmental and environmental factors. Analysis of cis-regulatory elements in the promoter regions of HvLHCs has revealed the presence of light-responsive elements as well as biotic and abiotic stress-responsive elements . Specifically, expression of these genes can be influenced by:

  • Light conditions: Light is a primary regulator of LHC gene expression

  • Abscisic acid (ABA): Physiologically high levels of ABA can enhance LHC expression

  • Environmental stresses: LHC genes show differential responses to multiple stresses, including drought, cold, heat, and wounding

The expression patterns of different LHC family members vary significantly under these conditions, suggesting they may have distinct functions in stress adaptation mechanisms .

What is the significance of allelic variations in LHC genes?

An EcoTILLING study revealed 23 nucleotide variations in the Lhcb1 gene of barley across 292 accessions from 35 different countries, including:

  • 3 insertions/deletions (indels)

  • 20 single nucleotide polymorphisms (SNPs)

  • 17 SNPs in the coding region with 9 missense changes

These variations formed 31 distinguishable haplotypes, with nucleotide diversity differing markedly based on geographic origins and species of accessions. Notably, accessions from Middle East Asia exhibited the highest nucleotide and haplotype diversity, and wild barley (H. spontaneum) showed greater nucleotide diversity than cultivated barley (H. vulgare) .

Five SNPs in the Lhcb1 gene were significantly associated with important agronomic traits:

  • Plant height

  • Spike length

  • Number of grains per spike

  • Thousand grain weight

  • Flag leaf area

  • Leaf color

These findings indicate that allelic variations in LHC genes may contribute to barley adaptation to diverse environments and could be valuable for crop improvement programs .

What are the optimal conditions for expressing recombinant LHC Ib-21?

For optimal expression of recombinant LHC Ib-21, the following methods have proven effective:

Expression System:

  • E. coli is commonly used for expressing the His-tagged full-length mature protein (amino acids 45-245)

  • The protein can be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage

  • Repeated freezing and thawing should be avoided; working aliquots can be stored at 4°C for up to one week

Purification Considerations:

  • The chloroplast transit peptide (amino acids 1-44) should be removed when expressing the mature protein

  • Inclusion of a His-tag facilitates purification by metal affinity chromatography

  • The tag type may be determined during the production process based on experimental requirements

How can researchers effectively detect and quantify LHC Ib-21 in experimental samples?

Several methods are available for detecting and quantifying LHC Ib-21:

Western Blotting:

  • Anti-Lhcb2 polyclonal antibodies have shown cross-reactivity with barley (H. vulgare) LHC proteins

  • For optimal results, load 3-20 μg of total protein and use antibody dilutions of 1:5000

  • Include appropriate controls, such as actin, for normalization

Immunochemical Detection:

  • Available antibody formats include:

    • ALP-conjugated

    • Biotin-conjugated

    • HRP-conjugated

    • DyLight® 488/594/650-conjugated for fluorescence detection

ELISA-based Quantification:

  • Commercial ELISA kits are available for quantitative detection of recombinant LHC Ib-21

  • Typical working quantities are around 50 μg, though other quantities are available for different experimental needs

What techniques can be used to study LHC Ib-21 protein-pigment interactions?

To study the interactions between LHC Ib-21 and its associated pigments:

HPLC Analysis:

  • Acetone extraction of pigments followed by HPLC analysis can determine the exact pigment composition and stoichiometry

  • This approach has been successfully used to identify chlorophyllide binding to related proteins

Spectroscopic Measurements:

  • Absorption spectroscopy can be used to analyze the binding of chlorophyll a and b to the protein

  • Fluorescence measurements, including 77K fluorescence, can provide insights into energy transfer characteristics, though some LHC-chlorophyllide complexes may not be detectable by this method

Structural Analysis:

  • Single highest scoring template modeling can be used to predict protein structure based on cryoEM structure of spinach PSII-LHCII with high confidence (>99%)

  • This can reveal information about the three α-helices that integrate into the thylakoid membrane and the binding sites for pigment molecules

How does LHC Ib-21 respond to different abiotic stresses at the molecular level?

Research has shown differential responses of LHC genes to various abiotic stresses:

Stress-Responsive Expression Patterns:

Stress TypeResponse of LHC Ib-21Associated Cellular Changes
Cold stressSlight upregulationEnhanced chloroplast organization, altered photosynthetic efficiency
DroughtInhibited expressionReduced photosynthetic rate, protective mechanism against excess light energy
ABA treatmentSlight upregulationHormonal signaling pathway activation
Light stressVariable (intensity dependent)Regulation via phosphorylation/dephosphorylation of LHC proteins

Molecular analyses show that these responses are linked to:

  • Presence of regulatory domains (SH3 domain, Rho domain, protein kinase C phosphorylation sites)

  • Phosphorylation/dephosphorylation as a primary regulatory mechanism for rapid response

  • GTP-mediated signaling affecting protein function

This suggests that LHC Ib-21 serves not only a light-harvesting function but also plays a role in plant stress adaptation mechanisms .

How can transcription factor analysis inform our understanding of LHC Ib-21 regulation?

Transcription factor analysis provides crucial insights into the regulation of LHC gene expression:

WRKY Transcription Factors:

  • WRKY40 has been identified as a key repressor that directly targets LHC genes

  • This transcription factor binds to specific motifs in LHC promoters, forming part of a regulatory network balancing positive and negative regulation in response to environmental cues

Experimental Approaches:

  • Reporter constructs with LHC promoters linked to luciferase can be used to study transcription factor interactions

  • Primer design for such constructs typically targets regions 900-1000bp upstream of the start codon

  • The primers used for a related LHC gene were:

    • Forward: 5′-GGGGTACCCGCAGGGGAAAGGTTCACAG-3′

    • Reverse: 5′-TCCCCCGGGTGCTTCGTGGAAAGTGATGC-3′ (976bp)

Researchers can apply similar approaches to study the regulation of LHC Ib-21, identifying specific transcription factors and cis-regulatory elements involved in its expression.

What role does LHC Ib-21 play in chloroplast development during de-etiolation?

During the critical transition from etiolated (dark-grown) to light-exposed seedlings, LHC proteins play specialized roles:

Temporal Expression Pattern:

  • Some LHC-related proteins accumulate transiently in the stroma of barley etiochloroplasts after 2 hours of light exposure

  • These proteins can be attached to the outer envelope of barley etiochloroplasts, with their import being light-dependent

Functional Role in Chlorophyll Metabolism:

  • LHC proteins may function as carriers for chlorophyllide during seedling de-etiolation

  • They help manage potentially phototoxic intermediates during the transition from etiolated to photosynthetically active states

  • Light-induced chloroplast development requires coordinated synthesis and assembly of photosynthetic complexes, with LHC proteins playing a pivotal role in this process

Experimental Evidence:

  • Import of precursor proteins (27-kD) is light-dependent and can be induced after feeding isolated plastids with the tetrapyrrole precursor 5-aminolevulinic acid

  • HPLC analyses and spectroscopic pigment measurements of acetone-extracted pigments have shown that some LHC-related proteins are complexed with chlorophyllide during this critical developmental transition

Understanding this role is essential for research on chloroplast biogenesis and the establishment of photosynthetic capacity in developing plants.

How can LHC Ib-21 be utilized in chloroplast genetic engineering?

LHC proteins and their encoding genes offer several opportunities for chloroplast genetic engineering applications:

Enhancing Photosynthetic Efficiency:

  • Modifying LHC genes can potentially improve light harvesting capacity and energy distribution

  • Engineered variants may enhance plant performance under suboptimal light conditions

Reporter Systems:

  • LHC promoters can be used to drive expression of reporter genes in specific tissues or developmental stages

  • Their light and stress responsiveness makes them valuable tools for studying plastid gene expression

Biotechnological Potential:

  • As part of chloroplast engineering strategies, LHC can contribute to developing plants with:

    • Enhanced drought tolerance

    • Improved salt tolerance

    • Better performance under variable light conditions

The high expression levels achievable in chloroplast transgenic systems (up to 70% of total leaf protein) make this an attractive platform for various biotechnological applications .

What CRISPR-based approaches can be used to study LHC Ib-21 function?

CRISPR technologies offer powerful tools for studying LHC Ib-21 function:

CRISPR/Cas9 for Gene Editing:

  • Targeted knockout of LHC Ib-21 to assess its specific contribution to photosynthesis

  • Introduction of specific mutations to study structure-function relationships

  • Generation of tagged versions for in vivo localization and interaction studies

CRISPR Activation (CRISPRa):

  • dCas9 fused with histone acetyl-transferase (HAT) can be used to enhance gene expression via chromatin remodeling

  • This approach has been successfully used for other genes involved in stress responses

  • For designing sgRNAs targeting LHC gene promoters, researchers should:

    • Target regions within 200bp upstream of the transcription start site

    • Select sequences with minimal off-target effects

    • Consider chromatin accessibility at the target site

Implementation Protocol:

  • Design sgRNAs targeting the promoter region of LHC Ib-21

  • Clone into a vector with dCas9-HAT fusion

  • Transform into appropriate plant material

  • Validate enhanced expression using qRT-PCR

  • Assess phenotypic consequences under various light and stress conditions

How can structural analysis of LHC Ib-21 inform protein engineering efforts?

Structural insights into LHC Ib-21 can guide protein engineering for enhanced functions:

Key Structural Features for Engineering:

  • Pigment Binding Sites:

    • The protein contains binding sites for 4 chlorophyll-a, 3 chlorophyll-b molecules, and one 1,2-dipalmitoyl-phosphatidyl-glycerole

    • Modifications to these sites could alter spectral properties and energy transfer efficiency

  • Membrane Integration Regions:

    • Three α-helices integrate into the thylakoid membrane

    • Engineering these regions could affect protein stability and assembly into photosynthetic complexes

  • Regulatory Domains:

    • SH3 domain (amino acids 146-207)

    • Two internal repeats (amino acids 105-140 and 216-251) with 44% identity

    • Modifications to these domains could alter regulatory responses

Engineering Strategies:

  • Site-directed mutagenesis of specific residues in pigment-binding pockets

  • Domain swapping with related proteins from extremophile organisms

  • Introduction of novel regulatory elements to modulate protein response to environmental cues

By leveraging these structural insights, researchers can design LHC variants with improved properties for both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.