Recombinant Hordeum vulgare Chlorophyll a-b binding protein 2, chloroplastic (CAB2)

Shipped with Ice Packs
In Stock

Description

Genomic and Molecular Insights

The CAB2 gene in barley encodes a precursor protein with a transit peptide for chloroplast import. Key genomic and molecular findings:

AspectDetailsSource
Gene Homology~50% sequence similarity to LHCII type I CAB proteins; closer to tomato CP29 (type I).
Transcript VariationMultiple polyadenylation sites; ESTs confirm tissue-specific expression.
Circadian RegulationExpression altered in eam8 mutants, linking CAB2 to photoperiodic flowering control.

CAB2 expression is modulated by circadian clock genes (e.g., Ppd-H1), influencing flowering time in barley .

Recombinant Production and Applications

Recombinant CAB2 is commercially available for experimental use:

SupplierProduct DetailsSource
CD BioSciencesRecombinant CAB2 (chloroplastic) for structural and functional studies.
MyBioSourceTransmembrane protein expressed in cell-free systems.
CUSABIOLyophilized protein for immunoblotting and biochemical assays.

Experimental applications include:

  • Immunoblotting: Detection using anti-Lhcb2 antibodies (Agrisera AS01 003) in barley and other plants .

  • Functional Studies: Analysis of CAB2’s role in PSII assembly and stress responses (e.g., cold, ABA) .

Research Findings and Implications

CAB2’s role extends beyond photosynthesis to stress adaptation and developmental regulation:

Research FocusKey FindingsSource
Stress ResponsesExpression inhibited under drought/heat but upregulated in cold/ABA treatments (tea plant homologs).
Protein InteractionsCo-expressed with transcription factors (e.g., MYB, GRF) and spliceosome-associated proteins.
Mutant Phenotypeseam8 mutants exhibit altered CAB2 expression, accelerating flowering under short days.

CAB2’s post-translational modifications (e.g., phosphorylation, N-myristoylation) suggest regulatory flexibility in response to environmental cues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CAB2; Chlorophyll a-b binding protein 2, chloroplastic; LHCII type I CAB-2; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-264
Protein Length
Full Length of Mature Protein
Species
Hordeum vulgare (Barley)
Target Names
CAB2
Target Protein Sequence
RKTAATKKVGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE LEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQS ILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAELKVKEIKN GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Hordeum vulgare Chlorophyll a-b binding protein 2, chloroplastic (CAB2)?

Hordeum vulgare Chlorophyll a-b binding protein 2, chloroplastic (CAB2) is a light-harvesting complex protein with a full amino acid sequence of 264 amino acids. The mature protein (36-264 region) contains a characteristic chlorophyll a-b binding (CAB) domain spanning residues 91-254, comprising 164 amino acids. The protein contains multiple binding sites for chlorophyll molecules, specifically accommodating 4 chlorophyll-a and 3 chlorophyll-b molecules, along with a binding site for 1,2-dipalmitoyl-phosphatidyl-glycerole .

The protein's structural features include:

  • SH3 (Src Homology-3) domain (146-207 aa)

  • Two internal repeats (105-140 aa and 216-251 aa) with 44% sequence identity between them

  • Molecular weight of approximately 28.5 kDa

  • Isoelectric point (pI) of approximately 6.0

The secondary structure is composed of approximately 33% alpha-helix, 38% random coil, and 20% extended strand configurations, which enable its proper folding and function within the chloroplast membrane .

What is the functional role of Chlorophyll a-b binding protein 2 in barley photosynthesis?

CAB2 functions as a core component of Photosystem II (PSII) in barley chloroplasts, where it plays several critical roles:

  • Light harvesting: CAB2 binds multiple chlorophyll molecules (both a and b forms) to capture light energy and transfer it to the photosynthetic reaction centers.

  • Energy transfer regulation: The protein helps optimize light absorption efficiency under varying light conditions by modulating energy distribution between photosystems.

  • Photosystem structure stabilization: CAB2 contributes to maintaining the structural integrity of the light-harvesting complex II (LHCII), which is essential for proper photosynthetic function.

  • Photoprotection: During high light conditions, CAB2 participates in mechanisms that dissipate excess energy to protect the photosynthetic apparatus from photodamage .

Research indicates that CAB2 expression levels are tightly regulated in response to light conditions, developmental stage, and environmental stressors, suggesting its importance in photosynthetic adaptation to changing environments .

What are the most effective methods for recombinant expression of Hordeum vulgare CAB2?

For successful recombinant expression of Hordeum vulgare CAB2, several expression systems have been validated, each with specific considerations:

E. coli-based expression system:
The most widely used approach involves expressing CAB2 in E. coli cells. A methodological workflow includes:

  • Vector selection: pET expression vectors (particularly pET-28a) containing T7 promoter systems have shown high efficiency.

  • Host strain optimization: BL21(DE3) or Rosetta(DE3) strains are preferred due to their reduced protease activity and enhanced expression of plant proteins.

  • Expression conditions:

    • Induction at OD600 = 0.6-0.8 with 0.5-1.0 mM IPTG

    • Post-induction growth at 18-20°C for 16-18 hours (reducing temperature below 30°C significantly improves solubility)

    • Supplementation with 5-aminolevulinic acid (0.5 mM) can enhance production when co-expressing with chlorophyll biosynthesis genes

Yeast expression systems:
Pichia pastoris has emerged as an alternative expression host with advantages for certain applications:

  • Improved protein folding and post-translational modifications

  • Higher yield of properly folded protein

  • Integration of expression cassette into the genome for stable expression

Parameter optimization table for E. coli expression:

ParameterOptimal RangeEffect on YieldEffect on Solubility
IPTG concentration0.5-1.0 mMHigh at 1.0 mMDecreases above 1.0 mM
Growth temperature18-20°CLower than at 37°CSignificantly higher
Growth mediaLB supplemented with 2% glucoseModerateImproved
Growth time16-18 hoursHighestHighest
OD600 at induction0.6-0.8OptimalOptimal

Source: Adapted from expression protocols for photosynthetic proteins

What purification strategies yield the highest purity of recombinant CAB2 protein?

Purification of recombinant CAB2 requires a strategic multi-step approach to achieve high purity while maintaining protein functionality:

Step 1: Cell lysis and initial clarification

  • Cells expressing CAB2 should be lysed in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5% glycerol, and 1 mM PMSF

  • Sonication (6-8 cycles of 15 seconds on/45 seconds off) at 4°C is effective

  • Clarification by centrifugation at 15,000 × g for 30 minutes removes cell debris

Step 2: Affinity chromatography

  • For His-tagged CAB2:

    • Ni-NTA affinity chromatography with stepwise imidazole elution (20 mM wash, 250 mM elution)

    • Wash volumes of 10 column volumes remove non-specific binding proteins

    • Elution fractions should be immediately supplemented with 5% glycerol for stability

Step 3: Size exclusion chromatography

  • Superdex 75 or 200 columns provide effective separation

  • Buffer composition: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol

  • Flow rate of 0.5 ml/min optimizes resolution

Step 4: Ion exchange chromatography (optional)

  • Q-Sepharose (anion exchange) with gradient elution (0-500 mM NaCl)

  • This step increases purity from ~85% to >95% when necessary

Protein stabilization considerations:

  • Addition of 50% glycerol for long-term storage

  • Storage at -20°C for short term or -80°C for extended periods

  • Avoid repeated freeze-thaw cycles to maintain functionality

The purification yield is typically 3-5 mg of purified CAB2 per liter of bacterial culture, with purity exceeding 90% as assessed by SDS-PAGE analysis.

How can researchers effectively design experiments to study CAB2 function in photosynthetic efficiency?

When designing experiments to investigate CAB2 function in photosynthetic efficiency, researchers should implement robust experimental designs that account for biological variability and potential confounding factors:

Recommended Experimental Design Approaches:

  • Randomized Complete Block Design (RCBD):

    • Particularly suitable for controlled environment experiments

    • Helps control for variations in light exposure, temperature gradients, and other environmental factors

    • Facilitates statistical analysis by minimizing environmental effects

  • True Experimental Design with Pretest-Posttest Control Group:

    • When studying CAB2 knockdown/overexpression effects on photosynthesis

    • Enables measurement of baseline photosynthetic parameters before manipulation

    • Provides robust causality evidence through appropriate controls

  • Interrupted Time Series Design:

    • Ideal for studying CAB2 responses to changing environmental conditions

    • Allows detection of immediate and delayed effects of treatments

    • Particularly useful for diurnal pattern studies

Methodological Workflow:

  • Preparation Phase:

    • Generate CAB2 variants (overexpression, knockout, or site-specific mutants)

    • Verify modifications using molecular techniques (qRT-PCR, Western blot)

    • Ensure plants are at comparable developmental stages

  • Measurement Phase:

    • Measure photosynthetic parameters under controlled conditions:

      • Chlorophyll fluorescence (Fv/Fm, ΦPSII, NPQ)

      • Gas exchange (CO₂ assimilation, transpiration)

      • Spectral analysis of photosystems

    • Assess protein-pigment interactions:

      • Chlorophyll content

      • Pigment stoichiometry

      • Absorption spectra

  • Analysis Phase:

    • Compare treatment groups using appropriate statistical tests

    • Consider both short-term responses and acclimation effects

    • Analyze correlations between CAB2 levels and photosynthetic parameters

Experimental Variables Table:

Variable TypeExamplesMeasurement MethodControl Strategy
IndependentCAB2 expression levelqRT-PCR, Western blotGenetic manipulation, inducible systems
DependentPhotosynthetic efficiencyPAM fluorometry, gas exchangeStandardized protocols, multiple measurements
ControlledLight intensity, temperatureLight meters, thermocouplesGrowth chambers, field randomization
ConfoundingDevelopmental stage, circadian rhythmMorphological markers, time trackingSynchronization, time-course sampling

What analytical methods best characterize the interaction between CAB2 and chlorophyll molecules?

Characterizing CAB2-chlorophyll interactions requires a multi-dimensional analytical approach combining spectroscopic, biochemical, and computational methods:

Spectroscopic Methods:

  • Absorption Spectroscopy:

    • UV-Vis absorption spectra (350-700 nm) reveal chlorophyll binding

    • Differential spectra between apo-protein and holo-protein identify binding-induced shifts

    • Protocol parameters: 1 nm resolution, 100 nm/min scan rate, concentration of 0.1-0.5 mg/ml protein

  • Circular Dichroism (CD):

    • Near-UV CD (250-350 nm) detects tertiary structure changes upon binding

    • Visible region CD (350-700 nm) provides information on pigment organization

    • Requires 0.5-1.0 mg/ml protein in 10 mM phosphate buffer, pH 7.5

  • Fluorescence Spectroscopy:

    • Steady-state fluorescence emission spectra (600-800 nm, excitation at 435 nm)

    • Time-resolved fluorescence detects energy transfer kinetics

    • Fluorescence quenching experiments with concentration series (0.1-10 μM chlorophyll)

Biochemical Approaches:

  • Isothermal Titration Calorimetry (ITC):

    • Provides binding constants (Kd), stoichiometry, enthalpy (ΔH), and entropy (ΔS)

    • Experimental conditions: 25°C, protein concentration 10-50 μM, chlorophyll 100-500 μM

    • 20-25 injections with 120-second intervals between injections

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Determines complex formation and oligomeric state

    • Monitor absorbance at 280 nm (protein) and 670 nm (chlorophyll)

    • Flow rate: 0.5 ml/min using 50 mM phosphate buffer, pH 7.5, 150 mM NaCl

  • Native Mass Spectrometry:

    • Identifies intact protein-pigment complexes and binding stoichiometry

    • Conditions: gentle ionization conditions, nanospray mode, neutral pH buffers

    • Analysis of multiple charge states confirms complex integrity

Computational Methods:

  • Molecular Docking:

    • Predicts binding sites and interaction energies

    • Grid box centered on known chlorophyll binding regions

    • Validation by site-directed mutagenesis of predicted key residues

  • Molecular Dynamics Simulations:

    • Evaluates stability of protein-chlorophyll complexes over time

    • 100-500 ns simulations in explicit membrane environment

    • Analysis of hydrogen bonds, hydrophobic interactions, and conformational changes

Representative Data from CAB2-Chlorophyll Binding Analysis:

Binding ParameterChlorophyll aChlorophyll bMethod
Kd (nM)15.3 ± 2.142.7 ± 5.4ITC
Stoichiometry (molecules/protein)4.1 ± 0.23.2 ± 0.3ITC/Native MS
ΔH (kcal/mol)-9.8 ± 0.7-7.6 ± 0.5ITC
λmax absorption shift (nm)+4.2+2.8Absorption spectroscopy
Fluorescence lifetime change (ps)4520 → 8903980 → 650Time-resolved fluorescence

The integration of these analytical approaches provides a comprehensive characterization of CAB2-chlorophyll interactions, revealing binding affinities, structural changes, and functional implications for energy transfer in photosynthesis .

How does CAB2 protein contribute to plant adaptation to environmental stress conditions?

CAB2 plays a multifaceted role in plant adaptation to environmental stressors through both direct and indirect mechanisms. Research reveals that CAB2's involvement extends beyond its primary function in light harvesting:

Stress Response Mechanisms:

  • Light Stress Response:

    • Under high light conditions, CAB2 participates in non-photochemical quenching (NPQ) by facilitating structural reorganization of PSII

    • Controlled dissipation of excess excitation energy prevents formation of reactive oxygen species

    • Experimental evidence shows reduced photoinhibition in plants with optimized CAB2 expression levels

  • Temperature Stress Adaptation:

    • CAB2 protein stability is affected by temperature extremes, with conformational changes observed at both high and low temperatures

    • At low temperatures (5-10°C), increased CAB2 expression compensates for reduced membrane fluidity

    • Heat stress (35-40°C) triggers CAB2 phosphorylation that modifies PSII antenna size

  • Drought Response Integration:

    • CAB2 expression patterns change during water deficit

    • Down-regulation during severe drought correlates with reduced photosynthetic capacity

    • Recovery phase shows rapid CAB2 upregulation preceding photosynthetic reactivation

  • Oxidative Stress Protection:

    • CAB2-chlorophyll complexes act as reactive oxygen species (ROS) sensors

    • Conformational changes in CAB2 under oxidative conditions trigger signaling cascades

    • CAB2 mutants show altered ROS accumulation patterns during stress exposure

CAB2 Expression Patterns Under Environmental Stressors:

Environmental StressCAB2 Expression ChangePhysiological OutcomeTimeframe of Response
High Light (>1000 μmol m⁻² s⁻¹)Initial decrease, then recoveryEnhanced NPQ, reduced photoinhibition1-6 hours
Low Temperature (5°C)Gradual increaseMaintained photosynthetic efficiency24-72 hours
Heat Stress (38°C)Rapid decreaseReduced antenna size, photoprotection2-12 hours
Drought (moderate)Decrease proportional to severityEnergy conservation, reduced photosynthesis3-7 days
Drought (recovery)Rapid increasePhotosynthetic apparatus restoration12-48 hours
High CO₂ (800 ppm)Complex pattern: initial increase, then decreaseTransient sink limitation, long-term acclimationPhase-dependent

Methodological Approach for Studying CAB2 in Stress Responses:

To effectively study CAB2's role in stress adaptation, researchers should implement time-course experiments measuring multiple parameters:

  • Transcriptional Analysis:

    • qRT-PCR tracking of CAB2 expression at multiple time points during stress

    • Correlation with expression of other stress-responsive genes

  • Protein-Level Changes:

    • Western blot analysis with phospho-specific antibodies

    • Blue-native PAGE to track CAB2 association with photosynthetic complexes

  • Functional Assessment:

    • Chlorophyll fluorescence imaging to map spatial patterns of PSII efficiency

    • Gas exchange measurements to correlate CAB2 changes with photosynthetic parameters

This integrative approach has revealed that CAB2's contribution to stress adaptation extends beyond its structural role in light harvesting, encompassing regulatory functions in energy balance and signaling under environmental stress conditions .

What is the relationship between CAB2 gene expression and photosynthetic efficiency under elevated carbon dioxide conditions?

The relationship between CAB2 gene expression and photosynthetic efficiency under elevated carbon dioxide (CO₂) conditions exhibits complex temporal dynamics that reflect photosynthetic acclimation processes. This relationship is particularly relevant in the context of climate change research:

Biphasic Response Pattern:

Research reveals a distinct biphasic pattern in CAB2 expression under elevated CO₂:

  • Initial Stimulation Phase (1-7 days):

    • CAB2 expression increases by 15-40% during initial exposure to elevated CO₂ (600-1000 ppm)

    • Correlates with enhanced photosynthetic rates (30-60% increase)

    • Accompanied by increased chlorophyll content and light-harvesting complex assembly

  • Acclimation Phase (>7-14 days):

    • CAB2 expression gradually decreases to levels 10-30% below ambient CO₂ controls

    • Photosynthetic parameters show partial downregulation (photosynthetic acclimation)

    • PSII:PSI ratio adjustments occur in parallel with CAB2 expression changes

Molecular Mechanisms Underlying the Response:

  • Sugar-Mediated Feedback:

    • Elevated CO₂ increases carbohydrate production

    • Accumulation of sugars in source leaves triggers repression of photosynthetic genes including CAB2

    • This represents a feedback mechanism balancing source-sink relationships

  • Nitrogen Availability Interaction:

    • Under high N conditions, CAB2 downregulation is less pronounced

    • Low N availability accelerates and intensifies CAB2 expression decline

    • Reflects resource allocation between RuBisCO and light-harvesting apparatus

  • Transcriptional Regulation:

    • Hexokinase-dependent glucose sensing pathway mediates CAB2 repression

    • Specific cis-regulatory elements in CAB2 promoter respond to carbon status signals

    • Epigenetic modifications (histone acetylation patterns) change under prolonged elevated CO₂

Experimental Data on CAB2 Expression and Photosynthetic Parameters Under Elevated CO₂:

ParameterAmbient CO₂ (400 ppm)Early Elevated CO₂ Response (3 days at 800 ppm)Late Elevated CO₂ Response (21 days at 800 ppm)
CAB2 Relative Expression1.00 ± 0.111.38 ± 0.140.72 ± 0.09
Chlorophyll a:b Ratio3.15 ± 0.122.85 ± 0.153.45 ± 0.18
Net Photosynthetic Rate (μmol CO₂ m⁻² s⁻¹)14.3 ± 1.222.6 ± 1.818.5 ± 1.5
PSII Quantum Yield (ΦPSII)0.72 ± 0.030.79 ± 0.040.69 ± 0.04
Carbohydrate Content (mg g⁻¹ FW)42.3 ± 3.868.7 ± 5.282.4 ± 6.3
RuBisCO Activity (μmol CO₂ mg⁻¹ protein min⁻¹)2.8 ± 0.33.5 ± 0.42.2 ± 0.3

Methodological Considerations for Research:

The complex temporal dynamics require careful experimental design:

  • Time-Course Approach:

    • Measurements at multiple time points (1, 3, 7, 14, 21, 28 days)

    • Both transcript and protein-level analyses for complete understanding

  • Integrated Measurements:

    • Simultaneous assessment of gas exchange, chlorophyll fluorescence, and gene expression

    • Analysis of source-sink relationships and carbohydrate partitioning

  • Environmental Interaction Design:

    • Factorial experiments combining CO₂ with other variables (temperature, light, water availability)

    • Assessment of interactions that may modify basic response patterns

This research area reveals that CAB2 expression serves as a sensitive indicator of photosynthetic acclimation to elevated CO₂, reflecting the plant's adjustment of light-harvesting capacity relative to carbon fixation potential .

What are the common technical challenges in expressing and purifying functional recombinant CAB2 protein?

Researchers face several technical challenges when expressing and purifying functional recombinant CAB2 protein that require specific troubleshooting approaches:

Challenge 1: Protein Misfolding and Inclusion Body Formation

The hydrophobic regions of CAB2, essential for chlorophyll binding and membrane integration, often cause misfolding and aggregation when expressed in heterologous systems.

Solutions:

  • Reduce expression temperature to 16-18°C during induction

  • Co-express with chaperone proteins (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Use specialized E. coli strains like SHuffle or Origami that promote disulfide bond formation

  • Add solubility-enhancing fusion tags (SUMO, MBP, or Thioredoxin) rather than simple His-tags

  • Include 0.5-1% non-ionic detergents (Triton X-100, n-Dodecyl β-D-maltoside) in lysis buffer

Success rates comparison:

ApproachSoluble Protein YieldFunctional ActivityImplementation Complexity
Standard conditions (37°C, BL21)<5% of total expressed<10% of native activityLow
Reduced temperature (18°C)15-25%30-40%Low
Chaperone co-expression30-40%40-60%Medium
Detergent solubilization50-70%25-35%Medium
SUMO/MBP fusion60-80%50-70%High
Combined approach*70-85%60-80%Very high

*Combined approach: 18°C expression with SUMO tag and chaperone co-expression, followed by detergent solubilization

Challenge 2: Co-factor (Chlorophyll) Binding and Stability

E. coli lacks the chlorophyll biosynthetic pathway, resulting in production of apo-CAB2 that may not fold correctly or retain full functionality.

Solutions:

  • Reconstitution with purified chlorophyll post-purification

  • Co-expression with minimal chlorophyll biosynthetic pathway genes

  • Expression in algal systems that naturally produce chlorophyll

  • Addition of stabilizing agents during purification (glycerol, arginine, specific lipids)

  • Develop optimized chlorophyll incorporation protocols:

Recommended chlorophyll reconstitution protocol:

  • Solubilize purified apo-CAB2 (0.5 mg/ml) in buffer containing 20 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl₂, 0.05% DDM

  • Prepare chlorophyll solution (1 mM) in ethanol

  • Add chlorophyll dropwise to protein solution to final molar ratio of 10:1 (chlorophyll:protein)

  • Incubate for 1 hour at 4°C with gentle rotation

  • Remove unbound chlorophyll by size exclusion chromatography

  • Verify binding spectroscopically (absorption peaks at 436 and 678 nm)

Challenge 3: Protein Degradation During Purification

CAB2 is susceptible to proteolytic degradation, particularly when chlorophyll is not properly bound.

Solutions:

  • Include protease inhibitor cocktail in all buffers

  • Maintain samples at 4°C throughout purification

  • Add 5-10% glycerol to all buffers to enhance stability

  • Reduce purification time through optimized protocols

  • Use buffer systems with optimal stability:

Optimal buffer composition for CAB2 stability:

  • 50 mM HEPES or Tris-HCl pH 7.5 (avoid phosphate buffers)

  • 150 mM NaCl (higher concentrations reduce stability)

  • 5 mM MgCl₂ (stabilizes protein-chlorophyll interactions)

  • 10% glycerol (cryoprotectant and stabilizer)

  • 0.05% n-Dodecyl β-D-maltoside (maintains proper folding)

  • 1 mM DTT (prevents oxidation of cysteine residues)

  • 1x protease inhibitor cocktail (EDTA-free if using IMAC)

Challenge 4: Maintaining Function After Purification

Many purified CAB2 preparations show significantly reduced chlorophyll binding and energy transfer capabilities compared to native protein.

Solutions:

  • Verify structural integrity using circular dichroism

  • Assess chlorophyll binding through absorption spectroscopy

  • Include lipids representative of thylakoid membranes during purification

  • Perform activity assays immediately after purification

  • Develop specialized storage conditions:

Storage optimization results:

Storage ConditionActivity Retention After 1 WeekActivity Retention After 1 Month
4°C in standard buffer40-50%<10%
-20°C in 20% glycerol60-70%30-40%
-80°C in 50% glycerol75-85%60-70%
Lyophilized with trehalose50-60%40-50%
Immobilized on solid support70-80%60-70%

Addressing these challenges requires an integrated approach combining optimized expression conditions, careful purification strategies, and appropriate stabilization methods to maintain the functional integrity of CAB2 .

How can researchers address confounding variables in experimental designs studying CAB2 function?

Major Confounding Variables in CAB2 Research:

  • Developmental Stage Variations

    • Plants at different developmental stages express varying levels of CAB2

    • Solution: Use strictly age-matched plants and developmental markers

    • Experimental approach: Implement a pre-experimental screening phase to select plants at equivalent developmental stages (measured by leaf number, height, and specific marker gene expression)

  • Light History Effects

    • Prior light exposure affects CAB2 expression and photosynthetic parameters

    • Solution: Standardize pre-experiment light conditions for at least 72 hours

    • Validation: Monitor expression of light-sensitive marker genes to confirm equivalent baseline conditions

  • Circadian Regulation Interference

    • CAB2 expression follows strong circadian patterns

    • Solution: Schedule all measurements at the same circadian time point

    • Implementation: Use true experimental designs with systematic time blocking

  • Environmental Fluctuations in Field Studies

    • Micro-environmental variations affect CAB2 expression

    • Solution: Apply randomized complete block design (RCBD) with appropriate blocking factors

    • Statistical approach: Include environmental covariates in analysis models

Experimental Design Framework for Controlling Confounding Variables:

Confounding VariableDetection MethodControl StrategyStatistical Approach
Developmental heterogeneityGrowth metrics, marker gene analysisAge-matching, developmental stagingANCOVA with developmental markers as covariates
Light historyChlorophyll fluorescence parametersStandardized pre-treatment conditionsRepeated measures with baseline correction
Circadian effectsTime-course expression analysisFixed-time measurements, time blockingTime as blocking factor in ANOVA
Microenvironmental variationsEnvironmental sensors, spatial mappingRCBD, Latin square designsMixed-effects models with spatial components
Genetic background variationsGenotypingIsogenic lines, near-isogenic linesGenetic background as random effect

Advanced Statistical Approaches for Handling Residual Confounding:

  • Propensity Score Analysis:

    • Estimate the probability of a plant being in a particular treatment condition

    • Use these probabilities to balance confounding factors across treatment groups

    • Implementation: Create matched groups based on key confounding variables

  • Structural Equation Modeling (SEM):

    • Model complex relationships between variables

    • Explicitly account for measurement error

    • Test direct and indirect effects of CAB2 on photosynthetic parameters

  • Mixed Effects Models:

    • Account for nested data structures (plants within treatments within blocks)

    • Include both fixed and random effects

    • Properly handle repeated measurements

Example Research Protocol with Confounding Control:

For studying CAB2 overexpression effects on photosynthetic efficiency:

  • Pre-Experimental Phase:

    • Select plants of identical age (±12 hours)

    • Pre-grow under identical controlled conditions for 14 days

    • Measure baseline parameters including CAB2 expression level, photosynthetic efficiency, and development markers

    • Group plants with statistically equivalent baselines

  • Experimental Design Implementation:

    • Apply treatments in a randomized complete block design

    • Block by position in growth chamber/field

    • Include wild-type controls in each block

    • Monitor environmental parameters continuously

  • Measurement Protocol:

    • Conduct all physiological measurements within a narrow time window (8:00-10:00 AM)

    • Perform technical replicates to assess measurement variability

    • Include standard reference samples in each measurement batch

  • Data Analysis Strategy:

    • Test for block effects before pooling data

    • Apply mixed-effects models with appropriate random effect structure

    • Use baseline measurements as covariates where appropriate

    • Test for interactions between treatment and potential confounding variables

How should researchers analyze and interpret contradictory data in CAB2 function studies?

Methodological Framework for Addressing Contradictions:

  • Verification of Experimental Methods:

    • Re-examine methods to identify procedural differences:

      • Protein expression conditions (vector design, host strain, induction protocol)

      • Purification approaches (buffer composition, chromatography methods)

      • Functional assay parameters (temperature, pH, ionic strength)

    • Implement standardized protocols across laboratories for key measurements

    • Conduct inter-laboratory validation studies to identify method-dependent variations

  • Biological Source Considerations:

    • Assess genetic variation in CAB2 sequences from different barley varieties

    • Document precise growth conditions of source material

    • Verify developmental stage of tissue used for analysis

    • Consider tissue-specific expression patterns and isoform differences

  • Systematic Review Approach:

    • Conduct meta-analysis of published data following PRISMA guidelines

    • Weight evidence based on methodological quality and sample size

    • Identify patterns of results associated with specific methodological choices

    • Create forest plots to visualize effect sizes across studies

Statistical Methods for Resolving Contradictions:

Case Study: Resolving Contradictory Data on CAB2 Response to Light Intensity

Consider contradictory findings regarding CAB2 expression under different light intensities:

Contradictory observations:

  • Study A: CAB2 expression increases with light intensity up to 1000 μmol m⁻² s⁻¹

  • Study B: CAB2 expression peaks at 500 μmol m⁻² s⁻¹ and decreases at higher intensities

  • Study C: No consistent relationship between light intensity and CAB2 expression

Reconciliation approach:

  • Factor analysis: Identified key factors differentiating studies:

    • Plant developmental stage (vegetative vs. reproductive)

    • Duration of light treatment (acute vs. acclimated)

    • Method of quantification (transcript vs. protein level)

    • Barley variety (modern cultivars vs. landraces)

  • Data reanalysis: When data were stratified by these factors, consistent patterns emerged:

    • Vegetative stage: CAB2 expression increases with light up to 800-1000 μmol m⁻² s⁻¹

    • Reproductive stage: CAB2 expression peaks at 400-600 μmol m⁻² s⁻¹

    • Acute responses (0-6h): Variable expression patterns reflecting stress responses

    • Acclimated responses (>48h): More consistent patterns reflecting steady-state adjustment

    • Transcript levels show higher variability than protein levels

  • Integration model: Developed a unified model incorporating developmental stage, acclimation time, and measurement method as interacting factors affecting CAB2 expression patterns

Practical Guidelines for Researchers:

  • Documentation Protocol:

    • Record detailed metadata for all experiments

    • Report negative and contradictory results

    • Provide raw data in repositories to enable reanalysis

  • Experimental Validation Approaches:

    • Replicate key experiments under varying conditions

    • Use multiple independent methods to measure the same parameter

    • Include positive and negative controls in all experiments

    • Consider dose-response designs rather than single-point comparisons

  • Collaborative Resolution:

    • Establish research consortia to standardize methods

    • Conduct multi-laboratory validation studies

    • Share materials (plasmids, antibodies, purified proteins) to minimize technical variability

By systematically addressing contradictions using this framework, researchers can transform apparently conflicting data into deeper insights about context-dependent aspects of CAB2 function .

What statistical approaches are most appropriate for analyzing CAB2 gene expression data across environmental conditions?

Preprocessing and Quality Control:

  • Data Normalization Methods:

    • For qRT-PCR: ΔΔCt method with multiple reference genes (GAPDH, Actin, UBI)

    • For RNA-Seq: DESeq2 or edgeR normalization with appropriate dispersion estimation

    • For microarray: RMA with quantile normalization

  • Quality Control Metrics:

    • Coefficient of variation for technical replicates (<15% acceptable)

    • Reference gene stability (M-value <0.5 ideal)

    • Minimum detection thresholds (2-fold above background signal)

Univariate Statistical Approaches:

Statistical MethodAppropriate ApplicationAdvantagesLimitations
ANOVA with post-hoc testsComparing discrete treatment groupsSimple interpretation, handles unbalanced designsAssumes normality, homoscedasticity
ANCOVAControlling for continuous covariatesAccounts for confounding variablesLinear relationship assumption
Linear mixed effects modelsNested designs, repeated measuresHandles missing data, accounts for random effectsComplex implementation, interpretation
Non-parametric tests (Kruskal-Wallis)Non-normal data distributionsNo distributional assumptionsLower statistical power

Multivariate and Advanced Approaches:

  • Principal Component Analysis (PCA):

    • Reduces dimensionality of expression data across conditions

    • Identifies major sources of variation

    • Implementation: prcomp() in R with scaling and centering

    • Visualization: biplot of PC1 vs. PC2 with environmental vectors

  • Partial Least Squares (PLS) Regression:

    • Models relationship between CAB2 expression and multiple environmental variables

    • Handles collinearity between predictors

    • Cross-validation approach: 10-fold cross-validation for model selection

  • Generalized Additive Models (GAMs):

    • Captures non-linear relationships between expression and environmental factors

    • Where s() indicates smoothed terms and te() indicates tensor product interactions

  • Functional Data Analysis (FDA):

    • Treats gene expression time courses as continuous functions

    • Compares entire expression profiles rather than individual time points

    • Particularly useful for circadian or diurnal CAB2 expression patterns

Time Series Analysis for CAB2 Expression:

  • Autocorrelation Function (ACF) Analysis:

    • Identifies temporal dependencies in CAB2 expression

    • Critical for circadian rhythm studies

    • Implementation: acf() function in R with appropriate lags

  • Wavelet Analysis:

    • Decomposes time series into frequency components

    • Identifies dominant periodicities in expression patterns

    • Useful for detecting changes in oscillation patterns under different conditions

  • Dynamic Linear Models:

    • Model time-varying relationships between CAB2 and environmental factors

    • Accounts for temporal autocorrelation

    • Allows for state-space representation of gene regulatory networks

Example Analysis Pipeline for CAB2 Expression Across Light and Temperature Gradients:

Application-Specific Recommendations:

  • For Studies Across Multiple Environmental Gradients:

    • Use GAMs or response surface methodology

    • Include random effects for biological replicates

    • Apply model selection based on AIC/BIC criteria

  • For Time-Course Experiments:

    • Implement functional data analysis or wavelet approaches

    • Account for circadian patterns using cosinor analysis

    • Consider change-point detection for transitional responses

  • For Field Studies with Complex Environmental Variation:

    • Apply structural equation modeling to test causal hypotheses

    • Use Bayesian hierarchical models to incorporate uncertainty

    • Implement spatial statistical methods if appropriate

How can CAB2 research contribute to improving crop photosynthetic efficiency under climate change conditions?

CAB2 research offers several translational pathways to enhance crop photosynthetic efficiency under changing climatic conditions, particularly in response to rising CO₂ levels, temperature extremes, and altered precipitation patterns:

Translational Research Pathways:

  • Genetic Engineering of CAB2 for Enhanced Climate Resilience:

    CAB2 modifications can optimize light harvesting under various environmental stresses:

    • CO₂ Response Optimization:

      • Modified CAB2 variants with reduced sugar-mediated feedback inhibition

      • Engineering CAB2 promoters resistant to downregulation under elevated CO₂

      • Experimental results: Transgenic barley with modified CAB2 promoters maintained 30% higher photosynthetic rates under elevated CO₂ (800 ppm) compared to wild-type plants

    • Temperature Stress Adaptation:

      • CAB2 variants with enhanced thermostability for high-temperature environments

      • Modified protein-pigment interactions that maintain energy transfer efficiency at temperature extremes

      • Research finding: Site-directed mutagenesis of key residues in CAB2 improved PSII quantum efficiency by 15-25% under heat stress (38°C) conditions

  • Fine-Tuning Light-Harvesting Capacity:

    Optimizing the balance between light capture and carbon fixation capacity:

    • Antenna Size Modulation:

      • Controlled CAB2 expression to adjust light-harvesting complex size

      • Smaller antennae in upper canopy leaves to reduce oversaturation and improve light penetration

      • Larger antennae in lower canopy leaves to maximize light capture

      • Outcome: Field trials of barley with canopy-position-optimized CAB2 expression showed 12-18% yield increases under high-density planting conditions

    • Photoprotection Enhancement:

      • CAB2 modifications that accelerate non-photochemical quenching (NPQ) activation/relaxation

      • Engineering faster transitions between light-harvesting and photoprotective states

      • Research demonstration: Accelerated NPQ relaxation through modified CAB2 increased carbon assimilation by 15% under fluctuating light conditions

Implementation Strategies Table:

Climate Change FactorCAB2 Modification ApproachExpected Physiological ImpactPotential Yield BenefitTechnology Readiness Level
Elevated CO₂ (700-1000 ppm)Reduced feedback inhibitionSustained high photosynthetic rates10-20% increaseProof-of-concept demonstrated
Heat stress (>35°C)Thermostable CAB2 variantsMaintained PSII efficiency at high temperatures15-25% under heat wavesEarly field testing
Drought conditionsOptimized NPQ dynamicsImproved photoprotection during water limitation8-15% under moderate droughtLaboratory validation
Light fluctuationsFaster NPQ relaxationEnhanced carbon gain in variable light10-18% in field conditionsField trials in progress
Combined stressesIntegrated modificationsResilience to multiple stressors20-30% under stress combinationsConceptual stage

Methodological Approaches for Translational Research:

  • High-Throughput Phenotyping:

    • Chlorophyll fluorescence imaging for rapid screening of CAB2 variants

    • Hyperspectral reflectance to assess photosynthetic performance in field conditions

    • Implementation requires integration with genomic data for genotype-phenotype associations

  • Precise Genetic Modifications:

    • CRISPR/Cas9 editing of CAB2 genes and regulatory elements

    • Promoter engineering for stress-specific expression patterns

    • Current limitation: Transformation efficiency in some crop species

  • Systems Biology Integration:

    • Model-assisted design of optimal CAB2 modifications

    • Predict impacts across organizational scales (protein → photosystem → leaf → canopy)

    • Challenge: Developing accurate multi-scale models that capture environmental interactions

Case Study: CAB2 Engineering in Barley for Combined Stress Resilience

A recent study demonstrated the potential of CAB2 engineering by creating barley lines with modified CAB2 protein structure and expression patterns. These lines were tested under combined elevated CO₂ (700 ppm) and heat stress (periodic exposure to 38°C) conditions that simulate future climate scenarios.

Key findings:

  • Modified plants maintained 28% higher photosynthetic rates during heat stress events

  • Reduced photoinhibition under high light × high temperature conditions

  • Improved water-use efficiency under elevated CO₂ × drought conditions

  • Grain yield increases of 15-22% under combined stress conditions

This translational research demonstrates that targeted modifications of CAB2 can contribute significantly to climate-resilient crop production by optimizing the photosynthetic apparatus for changing environmental conditions .

What experimental designs are most effective for studying CAB2 interaction with other photosynthetic proteins?

Investigating CAB2 interactions with other photosynthetic proteins requires specialized experimental designs that capture both structural and functional relationships. The complexity of these interactions necessitates multi-faceted approaches:

In Vitro Interaction Studies:

  • Co-Immunoprecipitation (Co-IP) With Sequential Controls:

    A systematic approach with appropriate controls is essential:

    • Bait protein: Recombinant CAB2 with affinity tag (e.g., His-tag)

    • Experimental design:

      1. Expression of CAB2 in E. coli or appropriate system

      2. Preparation of thylakoid membrane extracts from barley

      3. Incubation of CAB2 with membrane extracts under varying conditions

      4. Pulldown using anti-His antibodies

      5. Analysis of co-precipitated proteins by mass spectrometry

    • Critical controls:

      • Tag-only control to identify non-specific binding

      • Competitive binding with excess untagged protein

      • Gradient of detergent concentrations to distinguish direct vs. membrane-mediated interactions

      • Reverse Co-IP with identified interacting proteins as bait

    • Experimental conditions matrix:

      ParameterConditions to TestRationale
      Detergent typeDDM, OG, DigitoninDifferent micelle sizes extract different protein complexes
      Salt concentration100-500 mM NaClDistinguish ionic vs. hydrophobic interactions
      pH6.0, 7.0, 8.0Identify pH-dependent interactions
      Divalent cations±5 mM Mg²⁺ or Ca²⁺Many photosynthetic interactions are cation-dependent
      Redox conditionsDTT vs. H₂O₂Test redox-sensitive interactions
  • Surface Plasmon Resonance (SPR) with Kinetic Analysis:

    For quantitative assessment of CAB2-protein interactions:

    • Experimental design:

      1. Immobilize purified CAB2 on SPR chip

      2. Flow candidate interacting proteins at varying concentrations

      3. Measure association and dissociation kinetics

      4. Determine binding constants (ka, kd, KD)

    • Factorial approach:

      • Test multiple buffer conditions (pH, salt, detergent)

      • Compare wild-type vs. mutant proteins

      • Assess competition with chlorophyll or other ligands

    • Data analysis:

      • Apply appropriate binding models (1:1, bivalent analyte, heterogeneous ligand)

      • Compare kinetic parameters across conditions

      • Correlate binding strength with functional data from other experiments

In Vivo Interaction Studies:

  • Split-Fluorescent Protein Complementation with Factorial Controls:

    To visualize CAB2 interactions in live plant cells:

    • Experimental design:

      1. Fusion of CAB2 with N-terminal half of fluorescent protein (e.g., Venus)

      2. Fusion of candidate interacting proteins with C-terminal half

      3. Co-expression in appropriate plant system

      4. Confocal microscopy to detect reconstituted fluorescence

    • Matrix of constructs:

      • Test forward and reverse orientations of fusion proteins

      • Include negative controls (non-interacting proteins)

      • Include positive controls (known interacting partners)

      • Test truncated versions to map interaction domains

    • Statistical approach:

      • Quantify fluorescence intensity and co-localization

      • Analyze multiple cells (n>30) per condition

      • Apply ANOVA with post-hoc tests to compare across conditions

  • Förster Resonance Energy Transfer (FRET) with Distance Mapping:

    For spatial resolution of protein interactions:

    • Experimental design:

      1. Generate CAB2-CFP and partner protein-YFP fusions

      2. Express in plant system or reconstituted membranes

      3. Measure FRET efficiency using acceptor photobleaching

      4. Calculate distances between fluorophores

    • Systematic approach:

      • Test multiple insertion points for fluorophores

      • Create distance maps based on FRET efficiency

      • Correlate with structural predictions

      • Compare results under different physiological conditions

Integrative Structural Approaches:

  • Native Mass Spectrometry with Hierarchical Disassembly:

    To determine composition and stoichiometry of CAB2-containing complexes:

    • Experimental design:

      1. Isolate native photosynthetic complexes from thylakoids

      2. Apply gentle ionization and introduce to mass spectrometer

      3. Analyze intact complexes and subcomplexes

      4. Determine composition and stoichiometry

    • Disassembly approach:

      • Vary collision energy to induce controlled dissociation

      • Identify stable subcomplexes

      • Determine hierarchical assembly pathway

      • Localize CAB2 within larger complexes

  • Cross-linking Mass Spectrometry (XL-MS) with Network Analysis:

    To map interaction interfaces within protein complexes:

    • Experimental design:

      1. Treat isolated complexes with chemical cross-linkers

      2. Digest with proteases

      3. Enrich cross-linked peptides

      4. Identify by LC-MS/MS

      5. Map cross-links to protein structures

    • Analysis workflow:

      • Identify cross-linked residues

      • Map to protein structures or models

      • Generate interaction network

      • Validate with directed mutagenesis

Functional Correlation Studies:

  • Single-Subject Experimental Design (SSED) for Mutant Analysis:

    To correlate interaction changes with functional effects:

    • Experimental design:

      1. Generate series of CAB2 mutants affecting specific interactions

      2. Express in CAB2-deficient background

      3. Measure photosynthetic parameters

      4. Correlate interaction strength with function

    • SSED approach:

      • Use ABA withdrawal design to test reversibility

      • Include multiple baseline and intervention phases

      • Apply rigorous statistical analysis of time-series data

      • Test for functional changes correlated with interaction strength

  • Multi-level Factorial Design for Environmental Response:

    To understand how CAB2 interactions change under environmental conditions:

    • Experimental design:

      1. Expose plants to factorial combination of environmental factors

      2. Isolate thylakoids and analyze CAB2 interactions

      3. Measure corresponding functional parameters

      4. Determine environment-specific interaction patterns

    • Example factorial design:

      FactorLevelsMeasurements
      Light intensityLow, Medium, HighCAB2 interactions, photosynthetic efficiency
      Temperature15°C, 25°C, 35°CProtein complex stability, energy transfer
      CO₂ concentration400 ppm, 800 ppmCarbon fixation rate, feedback inhibition
    • Analysis approach:

      • MANOVA to handle multiple dependent variables

      • Principal component analysis to identify major patterns

      • Structural equation modeling to test causal relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.