Recombinant Hordeum vulgare Chlorophyll a-b binding protein of LHCII type III, chloroplastic (LHBC)

Shipped with Ice Packs
In Stock

Description

Production Methods

LHBC is heterologously expressed in diverse systems, including:

  • E. coli: Produces full-length or partial recombinant proteins with His-tags for affinity chromatography .

  • Yeast/Baculovirus: Used for eukaryotic post-translational modifications (e.g., disulfide bridging) .

  • Cell-Free Systems: Avoids host-related contamination but limits large-scale production .

Critical Steps in Recombinant Production

  1. Gene Cloning: LHBC is amplified from barley cDNA and inserted into expression vectors (e.g., pMD18-T) .

  2. Protein Refolding: In vitro pigment binding (chlorophyll a/b, xanthophylls) is essential for functional characterization .

  3. Purification: Chromatography (e.g., nickel affinity for His-tagged proteins) ensures ≥85% purity .

Functional Divergence from Lhcb1/Lhcb2

LHBC (Lhcb3) exhibits distinct properties compared to other LHCII subunits:

PropertyLHBC (Lhcb3)Lhcb1/Lhcb2
Chlorophyll a/b RatioLower (higher Chl b binding)Higher (balanced Chl a/b)
Spectral ShiftRed-shifted Chl a absorption (~2 nm)No significant shift
Xanthophyll BindingPreferential binding to L2/N1 sitesBroad specificity
Thermal StabilityHigher photostability under stressLower stability under heat

These traits position LHBC as a potential energy sink, mitigating photodamage under excess light .

Antibody Compatibility

Polyclonal antibodies (e.g., Anti-Lhcb3 from Agrisera) specifically target conserved regions of LHBC, enabling:

  • Western Blot: Detection of LHBC in thylakoid membranes (1:2000–1:7000 dilution) .

  • Immunoprecipitation: Isolation of LHBC-containing complexes for structural studies .

Cross-Reactivity:

OrganismReactivityApplications
Hordeum vulgareHighStress-response studies in barley
Arabidopsis thalianaModerateComparative LHCII research
Oryza sativaConfirmedAgronomic stress models

Role in Stress Adaptation

Genome-wide analyses reveal LHBC promoters contain stress-responsive elements (e.g., ABRE, W-box) . Functional studies show:

  • Drought Tolerance: LHBC-related genes are upregulated in drought-resistant barley genotypes, linked to ROS scavenging .

  • Heat/Salinity Responses: Differential expression patterns under abiotic stress, suggesting adaptive roles in photosynthetic regulation .

Agricultural Implications

  • Crop Improvement: Targeting LHBC for enhanced stress tolerance in barley breeding programs .

  • Photosynthetic Engineering: Modulating LHBC expression to optimize light-harvesting efficiency under fluctuating conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
LHBC; Chlorophyll a-b binding protein of LHCII type III, chloroplastic; CAB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-268
Protein Length
Full Length of Mature Protein
Species
Hordeum vulgare (Barley)
Target Names
LHBC
Target Protein Sequence
GNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRW AMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGF QVLLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMF SMFGFFVQAIVTGKGPLENLFDHLDDPVANNAWVFATKFAPGS
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

UniGene: Hv.637

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic function of LHCII type III protein in barley?

The LHCII type III protein in barley (Hordeum vulgare) is a light-harvesting complex apoprotein with a molecular mass of approximately 26.0 kD as determined by sodium dodecyl sulfate gel electrophoresis . It contains three membrane-spanning regions and binds several chlorophyll a and b molecules, as well as xanthophyll pigments . Functionally, it serves as part of the light-harvesting antenna that captures photons and transfers excitation energy to photosystem reaction centers, primarily associated with photosystem II (PSII).

The protein is encoded by the Lhcb3 gene and forms part of the LHCII trimeric complexes in association with Lhcb1 and Lhcb2 gene products . While less abundant than Lhcb1 proteins (which constitute the major component of LHCII), the type III protein plays a specific role in the structural organization of the photosynthetic apparatus and contributes to the efficiency of light capture under varying environmental conditions.

How does LHCII type III protein differ from other LHCII proteins in barley?

LHCII type III protein (Lhcb3) differs from other LHCII proteins in several key aspects:

FeatureLHCII Type III (Lhcb3)LHCII Type I (Lhcb1)LHCII Type II (Lhcb2)
Molecular mass26.0 kD26.9 kD27.5 kD
Relative abundanceLowest of the threeHighestIntermediate
Light induction responseAccumulates with similar timing as other typesMost abundant formAccumulates under low-light conditions
Phosphorylation capacityLimitedCan be phosphorylatedPrimary target for phosphorylation
Role in state transitionsMinimal involvementForms part of mobile poolMediates association with PSI when phosphorylated

Unlike Lhcb1 and Lhcb2, Lhcb3 proteins do not appear to participate significantly in the state transition process whereby LHCII dynamically associates with either PSII or PSI in response to changing light conditions . Additionally, while Lhcb2 appears in larger apparent molecular mass forms (28.3 and 28.7 kD) during the rapid phase of thylakoid development (8-24h), no corresponding higher molecular mass forms of type 3 LHCII apoproteins have been detected .

What are the optimal expression systems for producing recombinant barley LHCII type III protein?

For recombinant expression of barley LHCII type III protein, researchers should consider the following methodological approaches:

Bacterial Expression System (E. coli):

  • Clone the cDNA encoding the mature protein (without transit peptide) into an expression vector such as pET or pUC series

  • Express in E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Include a His-tag or other affinity tag for purification

  • Note that proper folding may require co-expression with chaperones

Cell-Free Expression System:

  • Particularly useful for membrane proteins

  • Allows incorporation into liposomes during translation

  • Enables direct biochemical studies without extensive purification

Yeast Expression System:

  • Pichia pastoris or Saccharomyces cerevisiae with inducible promoters

  • Better for proper folding than bacterial systems

  • Requires optimization of codon usage for efficient expression

When designing expression constructs, researchers should note that native LHCII type III protein has a molecular mass of 26.0 kD after processing . Expression efficiency can be monitored through Western blot analysis using antibodies directed against typical domains of type 3 LHCII apoproteins, similar to the methodological approach described for barley thylakoid protein characterization .

What are the most effective protocols for purifying recombinant LHCII type III protein while maintaining its native conformation?

Purification of functional recombinant LHCII type III protein requires specific strategies to maintain the protein's native conformation:

Recommended Purification Protocol:

  • Membrane Solubilization:

    • Solubilize membranes using mild detergents such as β-dodecyl maltoside (β-DM) or digitonin

    • Digitonin is particularly effective for preserving weak interactions between protein complexes

    • Use concentration of 1-2% detergent in a buffer containing 25 mM Tris-HCl (pH 7.5), 150 mM NaCl

  • Affinity Chromatography:

    • If His-tagged, use immobilized metal affinity chromatography (IMAC)

    • Include low concentrations of detergent (0.03-0.05% β-DM) in all purification buffers

  • Size Exclusion Chromatography:

    • Further purify using gel filtration to isolate properly folded protein

    • Can be used to analyze the oligomeric state of the protein

  • In vitro Reconstitution:

    • For functional studies, reconstitute with pigments (chlorophylls a/b and carotenoids)

    • Mix purified apoprotein with pigments in detergent solution followed by detergent removal

Confirmation of Native Conformation:

  • Analyze using native green gel electrophoresis system as described by Allen and Staehelin

  • Verify chlorophyll binding through absorption spectroscopy

  • Assess oligomerization state through BN-PAGE or lpBN-PAGE

How can researchers accurately determine the chlorophyll binding properties of recombinant LHCII type III protein?

To determine chlorophyll binding properties of recombinant LHCII type III protein, researchers should employ the following methodological approaches:

Spectroscopic Analysis:

  • Absorption Spectroscopy:

    • Measure absorption spectra between 350-750 nm

    • Calculate chlorophyll a/b ratio from absorption peaks at 663 nm (Chl a) and 645 nm (Chl b)

    • Typical Chl a/b ratio for LHCII proteins is approximately 1.3-1.5

  • Circular Dichroism (CD) Spectroscopy:

    • Analyze protein secondary structure and pigment organization

    • Characteristic negative bands at 650-655 nm indicate properly folded complexes

  • Fluorescence Spectroscopy:

    • Measure fluorescence emission spectra with excitation at 440 nm (Chl a) and 470 nm (Chl b)

    • Energy transfer efficiency can be calculated from emission profiles

Biochemical Characterization:

  • Pigment Extraction and HPLC Analysis:

    • Extract pigments using acetone:methanol (7:3 v/v)

    • Quantify individual pigments by HPLC

    • Compare pigment stoichiometry with native protein

  • Native Gel Electrophoresis:

    • Use native green gel system to preserve pigment-protein interactions

    • Analyze migration patterns compared to native complexes

Quantitative Analysis Template:

ParameterMethodExpected Values for LHCII Type III
Chlorophyll a/b ratioSpectrophotometry1.3-1.5
Total chlorophyll contentAcetone extraction12-14 molecules per monomer
Carotenoid contentHPLC analysis3-4 molecules per monomer
Energy transfer efficiencyFluorescence lifetime>90%
Thermal stabilityCD thermal denaturationTm = 65-70°C

What techniques are most suitable for studying the assembly of LHCII type III protein into functional complexes?

For studying the assembly of LHCII type III protein into functional complexes, researchers should employ a combination of biochemical, biophysical, and imaging techniques:

Native Gel Electrophoresis Approaches:

Microscopy and Imaging:

  • Electron Microscopy:

    • Negative staining for structural analysis of purified complexes

    • Cryo-EM for high-resolution structural determination

  • Atomic Force Microscopy:

    • Analyze topography of membrane-reconstituted complexes

    • Study dynamic assembly processes in native-like environments

Functional Association Analysis:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label different components with fluorescent probes

    • Monitor assembly through changes in energy transfer

  • Crosslinking Mass Spectrometry:

    • Identify interaction interfaces between LHCII type III and other proteins

    • Map the topology of assembled complexes

The research by Järvi et al. demonstrated that using lpBN-PAGE with digitonin solubilization is particularly effective for preserving and visualizing the associations between LHCII and photosystems that form during state transitions .

How does LHCII type III protein contribute to the photosynthetic efficiency in barley chloroplasts?

The LHCII type III protein contributes to photosynthetic efficiency in barley through several mechanisms:

Structural Organization of PSII-LHCII Supercomplexes:

  • LHCII type III (Lhcb3) plays a specific role in the organization of PSII-LHCII supercomplexes

  • Studies with knockdown mutants demonstrate that Lhcb3 cannot be functionally replaced by Lhcb1 or Lhcb2 for maintaining proper PSII supercomplex structure

  • The protein participates in forming stable connections within the photosynthetic apparatus

Light Harvesting and Energy Transfer:

Adaptation to Light Conditions:

  • During light-induced greening of etiolated barley seedlings, LHCII type III proteins accumulate simultaneously with other LHCII types but with specific temporal patterns

  • The apical leaf segments show more rapid accumulation (<4h) compared to basal segments (4-8h)

  • This developmental gradient contributes to the plant's ability to optimize photosynthetic capacity across the leaf

Comparative Contribution to Photosynthetic Parameters:

ParameterContribution of LHCII Type IIIExperimental Evidence
PSII quantum yield (Fv/Fm)Moderate contribution to maximum quantum efficiencyReduction in mutants lacking type III
Non-photochemical quenching (NPQ)Limited role compared to Lhcb1/Lhcb2Primarily dependent on other LHCII proteins
State transitionsMinimal involvementDoes not participate significantly in LHCII migration
Grana stackingContributes to proper thylakoid architectureAffects number of layers in grana structures

What are the methodological approaches for studying phosphorylation patterns of LHCII type III protein?

To study phosphorylation patterns of LHCII type III protein, researchers should employ these methodological approaches:

Detection of Phosphorylation:

  • Phosphoprotein-Specific Staining:

    • Pro-Q Diamond phosphoprotein gel stain for SDS-PAGE gels

    • Compare with total protein stains (e.g., Coomassie Blue)

  • Immunoblotting Techniques:

    • Anti-phosphothreonine antibodies

    • Phosphorylation-site specific antibodies if available

  • Mass Spectrometry:

    • Phosphopeptide enrichment using TiO₂ or IMAC

    • LC-MS/MS for identification of specific phosphorylation sites

    • Quantitative approaches (SILAC, TMT labeling) for comparative studies

Phosphorylation Dynamics Analysis:

  • In Vitro Kinase Assays:

    • Incubate purified LHCII type III with thylakoid-associated kinases (e.g., STN7, STN8)

    • Analyze using radioactive [γ-³²P]ATP or phosphorylation-specific detection methods

  • In Vivo Studies:

    • Expose plants to different light conditions to modulate phosphorylation

    • Isolate thylakoids and analyze phosphorylation status

    • Time-course studies during state transitions

While LHCII type III (Lhcb3) has not been shown to undergo significant phosphorylation compared to Lhcb1 and Lhcb2, understanding its phosphorylation pattern is important for comprehensive characterization . The chloroplast serine-threonine protein kinase STN7 is responsible for phosphorylating Lhcb1 and Lhcb2 at a Thr residue close to the N terminus, driving state transitions and functional redistribution of LHCII between PSII and PSI . A second homologous kinase, STN8, also has the capacity to phosphorylate LHCII, but its activity toward the complex is much lower than that of STN7 .

How can LHCII type III protein be used in synthetic biology approaches to enhance photosynthetic efficiency?

LHCII type III protein offers several opportunities for synthetic biology approaches to enhance photosynthetic efficiency:

Engineering Expanded Light-Harvesting Capacity:

  • Modified Spectral Properties:

    • Engineer LHCII type III protein to bind alternative pigments

    • Introduce mutations to alter chlorophyll a/b binding ratios

    • Extend light absorption into green or far-red regions of the spectrum

  • Heterologous Expression in Cyanobacteria:

    • Express modified barley LHCII type III in cyanobacteria

    • Create hybrid light-harvesting systems with enhanced spectral range

    • Potential for 5-10% increase in total light capture efficiency

Optimizing Energy Transfer and Photoprotection:

  • Engineered Energy Coupling:

    • Modify protein-protein interaction domains to optimize coupling with photosystems

    • Design variants with enhanced excitation energy transfer efficiency

    • Engineer interactions with photoprotective proteins for improved NPQ

  • Stress Tolerance Enhancement:

    • Design variants with improved stability under temperature stress

    • Engineer faster relaxation kinetics for photoprotection

Experimental Approach Framework:

  • Structure-guided Protein Engineering:

    • Use crystal structure information to target specific amino acids

    • Focus on pigment-binding sites and protein-protein interaction domains

  • Directed Evolution:

    • Develop high-throughput screening for desired properties

    • Select for variants with enhanced stability or altered spectral properties

  • Validation in Heterologous Systems:

    • Express engineered variants in model systems

    • Measure functional parameters (absorption spectra, energy transfer efficiency)

    • Test in vivo performance in transgenic plants

The developmental gradient observed in barley, where LHCII proteins appear sooner in apical than in basal leaf segments , provides insights into natural optimization of light-harvesting machinery that could inform synthetic biology approaches.

What methodological considerations are important when studying interactions between LHCII type III protein and other components of the photosynthetic apparatus?

When studying interactions between LHCII type III protein and other components of the photosynthetic apparatus, researchers should consider these methodological approaches:

Isolation of Native Protein Complexes:

  • Optimized Membrane Solubilization:

    • Digitonin (1-2%) for preserving weak interactions and large supercomplexes

    • β-dodecyl maltoside (1%) for studying core complexes

    • Compare results from different detergents to understand interaction hierarchy

  • Fractionation of Thylakoid Membranes:

    • Separate grana and stroma thylakoids to determine localization

    • Analyze distribution between membrane domains using antibodies against type 3 LHCII apoproteins

Interaction Analysis Techniques:

  • Native Gel Electrophoresis Systems:

    • Large-pore Blue Native (lpBN) PAGE with digitonin solubilization to preserve weak interactions

    • 2D native/SDS-PAGE to resolve individual components of complexes

  • Co-immunoprecipitation:

    • Use antibodies against LHCII type III protein to pull down interaction partners

    • Confirm specificity with appropriate controls

  • Crosslinking Studies:

    • Chemical crosslinking followed by mass spectrometry

    • Identify precise interaction interfaces and topology

Dynamic Interaction Analysis:

  • FRET-based Approaches:

    • Fluorescently label LHCII type III and potential interaction partners

    • Monitor dynamic associations in response to light conditions

  • Single Particle Analysis:

    • Cryo-EM of isolated complexes under different conditions

    • Resolve structural changes during state transitions

Studies have shown that loss of Lhcb1 affects the pigment-protein complex composition of thylakoids, while Lhcb2 is essential for the formation of state transition-specific PSI-LHCII complexes . Understanding how LHCII type III fits into this dynamic system requires careful consideration of isolation methods and analysis techniques that preserve native interactions.

What are the common challenges in expressing and purifying recombinant LHCII type III protein, and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant LHCII type III protein. Here are the most common issues and recommended solutions:

Challenge 1: Low Expression Yields

  • Problem: LHCII proteins often express poorly in heterologous systems, particularly in E. coli.

  • Solutions:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (BL21(DE3), C41(DE3), C43(DE3))

    • Lower induction temperature (16-20°C) and use lower inducer concentrations

    • Consider cell-free expression systems that bypass toxicity issues

Challenge 2: Protein Misfolding and Aggregation

  • Problem: Membrane proteins like LHCII often misfold and form inclusion bodies.

  • Solutions:

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Express as fusion with solubility-enhancing tags (MBP, TrxA, SUMO)

    • Develop refolding protocols from inclusion bodies

    • Consider expression in chloroplast-containing systems (e.g., Chlamydomonas)

Challenge 3: Pigment Incorporation

  • Problem: Obtaining properly pigmented protein complexes is challenging.

  • Solutions:

    • Express in photosynthetic organisms that naturally produce chlorophylls

    • Develop in vitro reconstitution protocols with purified pigments

    • Use detergent mixtures optimized for pigment solubility during reconstitution

Context 1: Structural Studies

  • Common Issues:

    • Heterogeneity in protein preparations

    • Insufficient resolution in structural analysis

  • Troubleshooting Approaches:

    • Implement additional purification steps (ion exchange, size exclusion)

    • Screen different detergents and buffer conditions systematically

    • Use limited proteolysis to identify flexible regions that may impede crystallization

    • For cryo-EM, optimize grid preparation and vitrification conditions

Context 2: Functional Studies

  • Common Issues:

    • Low energy transfer efficiency

    • Unstable complexes under measurement conditions

  • Troubleshooting Approaches:

    • Verify chlorophyll binding stoichiometry and pigment ratios

    • Ensure complete reconstitution with all necessary pigments

    • Optimize buffer conditions to stabilize complexes

    • Compare results with native protein isolated from barley thylakoids

Context 3: Interaction Studies

  • Common Issues:

    • Non-specific interactions

    • Disruption of native interactions during isolation

  • Troubleshooting Approaches:

    • Optimize detergent concentration (use minimum required)

    • Compare results using different solubilization methods

    • Use lpBN-PAGE with digitonin for preserving weak interactions

    • Include appropriate controls for interaction specificity

Methodological Validation Framework:

Experimental ApproachValidation MethodExpected Result for Properly Functioning System
Absorption spectroscopyCompare with native proteinMatching peak positions and Chl a/b ratio
Circular dichroismCompare secondary structureSimilar CD spectrum in visible and UV regions
Native gel electrophoresisMigration patternSimilar mobility to native complexes
Energy transferFluorescence lifetime measurements>90% efficiency from Chl b to Chl a
Protein-protein interactionsCo-migration in lpBN-PAGEFormation of supercomplexes with expected composition

Research on barley mutants altered in chlorophyll biosynthesis has provided valuable insights into the impact of pigmentation changes on thylakoid membrane organization . When troubleshooting experiments with recombinant LHCII type III, comparing results with these characterized mutants can provide context for interpreting observed phenotypes and functional properties.

What are the emerging research questions regarding the role of LHCII type III protein in environmental adaptation of barley?

Several emerging research questions are shaping the future of LHCII type III protein research in the context of environmental adaptation:

Drought and Temperature Stress Responses:

  • How does LHCII type III protein composition change during drought stress in barley?

  • What role does LHCII type III play in temperature-dependent remodeling of the photosynthetic apparatus?

  • How do the kinetics of LHCII type III accumulation during de-etiolation compare under normal versus stress conditions?

Climate Change Adaptation:

  • How does elevated CO₂ affect the stoichiometry of LHCII type III relative to other antenna proteins?

  • What are the mechanisms by which LHCII type III contributes to acclimation to fluctuating light conditions?

  • How do different barley varieties with varying stress tolerance differ in their LHCII type III properties?

Developmental and Tissue-Specific Regulation:

  • What is the molecular basis for the differential accumulation of LHCII type III in apical versus basal leaf segments?

  • How does the proplastid-to-chloroplast developmental gradient across the barley leaf blade regulate LHCII type III expression?

  • What signals coordinate the assembly of LHCII type III into functional complexes during chloroplast biogenesis?

Methodological Approaches for Future Studies:

  • Utilize barley's natural genetic diversity and available mutant populations

  • Apply CRISPR-Cas9 gene editing to create targeted modifications in LHCII type III

  • Develop advanced imaging techniques to visualize LHCII dynamics in vivo

  • Integrate multi-omics approaches (transcriptomics, proteomics, metabolomics) to understand system-level responses

The developmental gradient observed in barley, where LHCII proteins appear sooner in apical than in basal leaf segments , provides a valuable experimental system for studying spatial regulation of photosynthetic apparatus assembly that could inform future research on environmental adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.