Recombinant Hordeum vulgare Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant cemA is synthesized using heterologous expression systems. While the exact host for barley cemA is unspecified in available data, related chloroplast envelope proteins (e.g., rice cemA) are expressed in E. coli with N-terminal His tags .

ParameterSpecification
Expression Region1–230 amino acids (full-length)
TagN-terminal His tag (type determined during production)
StorageTris-based buffer with 50% glycerol; store at –20°C or –80°C
PurityOptimized for ELISA and structural studies
SourceHordeum vulgare (barley)

Data compiled from product specifications .

Role in Chloroplast Membrane Dynamics

CemA is essential for maintaining chloroplast envelope integrity. Studies in maize and tobacco homologs reveal:

  • Localization: Integral inner envelope protein, distinct from thylakoid membrane proteins .

  • Targeting Mechanism: Ribosomes synthesizing cemA show atypical partitioning between soluble and membrane fractions, suggesting divergent co-/post-translational integration signals compared to thylakoid proteins .

Environmental Interactions

  • CO₂ Transport: The cyanobacterial homolog cotA (with 40% sequence similarity) is crucial for CO₂ uptake, implicating cemA in ion or metabolite transport across chloroplast membranes .

  • Stress Response: Envelope proteins like cemA mediate chloroplast interactions with cytosolic stressors, though direct evidence in barley requires further study .

Research Applications

Recombinant cemA is utilized in:

  • Membrane Protein Studies: Investigating targeting mechanisms of chloroplast-encoded envelope proteins .

  • Transport Assays: Functional analyses of CO₂ or metabolite transport using homologs .

  • Antibody Production: Serves as an antigen for ELISA-based detection tools .

Comparative Analysis with Orthologs

OrganismProteinFunctionExpression System
Hordeum vulgarecemAInner envelope membrane integrationUnspecified
Oryza sativa (rice)cemAHomologous structure/functionE. coli
Synechocystis sp.CotACO₂ transportNative

Data derived from comparative studies .

Open Questions and Future Directions

  • Mechanistic Details: How cemA’s TMS domains engage with envelope translocons remains unresolved .

  • Stress Adaptation: Potential roles in abiotic stress responses warrant exploration via knockout barley models.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
cemA
Target Protein Sequence
MKKKKALPSLLYLVFIVLLPWGVSSSFNKCLELWIKNWWNTRQSETLLTDIQEKRILERF IELEELSLLDEMIKGKLKTHVQKPPTGIHKEIIQWVKINNEDHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELVIRWVYND FGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What are the most effective expression systems for producing recombinant cemA protein?

Barley grain offers two primary modes for producing recombinant proteins, including membrane proteins like cemA:

Expression System Comparison:

Expression SystemPromoter TypeLocationYieldAdvantages
Aleurone-specific systemα-amylase promoterAleurone cells during germination~1 μg/mg soluble proteinSignal peptide directs export into endosperm
Endosperm development systemHordein gene (Hor3-1) promoterDeveloping endosperm~54 μg/mg soluble proteinHigher yield, stable accumulation

The endosperm development system utilizing the D hordein gene (Hor3-1) promoter has shown superior results for recombinant protein expression. For optimal results with this system, codon optimization to a C+G content of ~63% and synthesis as a precursor with a signal peptide for transport through the endoplasmic reticulum and targeting into storage vacuoles is recommended . The primary challenge with cemA is its hydrophobic nature, which may require specialized extraction methods such as organic solvent extraction to obtain purified protein for analysis .

How can researchers optimize the isolation and purification of recombinant cemA protein?

For effective isolation of hydrophobic membrane proteins like cemA from chloroplast envelopes, a multi-step approach is recommended:

  • Membrane fraction preparation:

    • Develop specialized procedures for highly purified envelope membrane isolation from barley chloroplasts

    • Utilize differential centrifugation techniques to separate envelope membranes from other cellular components

  • Protein extraction methods:

    • Employ chloroform/methanol extraction for highly hydrophobic regions

    • Use alkaline treatments (pH >11.0) to extract peripheral membrane proteins

    • Apply saline treatments to retrieve proteins with ionic interactions

  • Chromatographic separation:

    • Implement sequential polyethylene glycol precipitation

    • Utilize fast protein liquid chromatography for final purification steps

    • Apply size exclusion chromatography to confirm native molecular weight

This combined approach allows for efficient isolation of membrane proteins like cemA while maintaining their native structure. For recombinant cemA specifically, extraction efficiency can be verified using SDS-PAGE analysis followed by tandem mass spectrometry . Western blotting with specific antibodies should be used to confirm protein identity and assess purity levels.

What techniques are most effective for characterizing cemA protein structure and interactions?

Characterization of cemA structure and interactions requires multiple complementary approaches:

  • Structural analysis:

    • Apply short-wave infrared (SWIR) spectral imaging to obtain spectral fingerprints

    • Utilize ANOVA-simultaneous component analysis (ASCA) to determine protein conformational changes

    • Implement X-ray crystallography for detailed structural information

  • Interaction studies:

    • Chemical crosslinking to identify protein-protein interactions (successful with other envelope proteins)

    • Co-immunoprecipitation with antibodies against cemA to isolate interaction complexes

    • FRET (Förster Resonance Energy Transfer) analysis for in vivo interaction studies

  • Functional characterization:

    • Liposome reconstitution for transport studies

    • Electrophysiological measurements to assess channel functionality

    • Ligand binding experiments to identify potential substrates

Research has demonstrated that combining multiple techniques provides a comprehensive understanding of chloroplast envelope membrane proteins. For example, similar approaches with other envelope proteins have successfully identified functions in ion and metabolite transport, protein import machinery, and chloroplast lipid metabolism .

How does cemA expression change during barley germination and development?

CemA expression is developmentally regulated during barley germination and is influenced by environmental factors:

Expression Patterns During Germination:

Germination StageRelative cemA ExpressionPhysiological ProcessAssociated Changes
Pre-germinationLowDormancyLimited chloroplast development
Early germination (0-24h)IncreasingImbibitionWater uptake initiates activation
Mid-germination (24-48h)Peak expressionChloroplast developmentEnvelope membrane formation
Post-germinationStabilizedFunctional chloroplastsMaintenance of membrane integrity

The expression profile can be analyzed using short-wave infrared (SWIR) spectral fingerprinting combined with ASCA, which has shown significant (p<0.0001) effects of germination status, germination time, and their interaction on spectral data for various barley varieties. This indicates that germination induces significant changes in protein composition, including chloroplast membrane proteins .

Different barley varieties show distinct germination profiles that vary as a function of time, suggesting that cemA expression and activity may vary between cultivars, potentially relating to their differential response to environmental stresses.

What is the role of cemA in stress tolerance mechanisms in barley?

While specific roles of cemA in stress response are still being characterized, research on chloroplast envelope membrane proteins indicates potential functions in stress adaptation:

  • Salinity stress response:

    • QTL mapping has identified regions on chromosome 2H associated with salinity tolerance during germination

    • Receptor-like protein kinases co-segregating with tolerance markers may interact with envelope membrane proteins

    • Tolerance index variations of 9.06%-11.12% have been associated with different membrane protein markers

  • Metabolomic reconfiguration:

    • Under stress conditions (e.g., fungal pathogens), barley undergoes metabolomic reconfiguration

    • Chloroplast membrane proteins may participate in retrograde signaling for adaptive responses

    • Priming agents like 3,5-DCAA (200 μM) can activate defense mechanisms involving chloroplast functions

  • Oxidative stress management:

    • Envelope proteins are involved in responses to oxidative stress

    • Potential role in maintaining redox homeostasis during stress conditions

    • Association with proton gradients and energy dissipation mechanisms

The precise molecular mechanisms by which cemA contributes to these processes require further investigation through knockout and overexpression studies in transgenic barley lines.

How can CRISPR/Cas9 technology be utilized for functional characterization of cemA?

CRISPR/Cas9 offers powerful approaches for investigating cemA function through targeted genome editing:

Methodological approach for cemA functional analysis:

  • Design and construct CRISPR/Cas9 vectors:

    • Target specific regions of the cemA gene

    • Design guide RNAs with high specificity and low off-target effects

    • Clone into appropriate vectors for barley transformation

  • Plant transformation and screening:

    • Transform immature barley embryos via Agrobacterium-mediated transformation

    • Select transformants using appropriate markers

    • Confirm gene editing through sequencing and identify homozygous knockout lines

  • Phenotypic analysis:

    • Analyze growth, development and chloroplast structure in knockout plants

    • Test response to various stresses (salinity, drought, pathogens)

    • Examine chloroplast ultrastructure using electron microscopy

  • Molecular characterization:

    • Analyze expression of UPR genes (PDI, CRT, and BiP) in response to stress inducers like tunicamycin

    • Use RT-qPCR for expression analysis with appropriate reference genes

    • Cross cemA mutants with plants expressing reporter proteins to study impact on protein transport

Recent studies have demonstrated that CRISPR/Cas9-generated homozygous barley lines can be effectively crossed with other transgenic lines to study gene function interactions. RT-qPCR analysis should be performed using appropriate reference genes (like actin) as controls for DNA contamination .

How do cemA homologs vary across different plant species and what are the evolutionary implications?

The evolutionary analysis of cemA reveals important patterns in chloroplast envelope protein conservation:

  • Structural conservation:

    • Chloroplast envelope proteins evolved from prokaryotic ancestors

    • CemA belongs to a family of preprotein and amino acid transporters found in free-living bacteria and endosymbiotic organelles

    • The protein contains conserved transmembrane domains across species

  • Functional divergence:

    • Specialized roles in different plant species related to environmental adaptation

    • Variations in expression patterns correlate with photosynthetic strategies

    • Species-specific interaction partners may influence function

  • Ortholog identification:

    • Cross-species comparisons identify conserved functional domains

    • Database analyses can identify related proteins in other photosynthetic organisms

    • Expression patterns may differ between monocots and dicots

Comparative analysis of cemA orthologs can provide insights into chloroplast evolution and adaptation to different environmental conditions. Future research should focus on identifying species-specific modifications that contribute to functional specialization in different plant lineages.

What proteomic approaches are most effective for studying cemA interactions with other chloroplast proteins?

Advanced proteomic approaches offer powerful tools for characterizing cemA interactions:

  • Sample preparation strategies:

    • Develop procedures for highly purified envelope membranes

    • Extract proteins using different methods (organic solvents, alkaline/saline treatments)

    • Preserve protein complexes through gentle solubilization techniques

  • Mass spectrometry approaches:

    • Liquid chromatography tandem mass spectrometry (LC-MS/MS) for protein identification

    • Analyze multiple envelope membrane subfractions to increase coverage

    • Apply chemical crosslinking followed by MS analysis to identify interaction partners

  • Data analysis methods:

    • Use specialized BLAST-based programs to search protein, EST, and genomic databases

    • Identify post-translational modifications like N-alpha acetylation

    • Validate localization of interacting proteins through multiple strategies

This approach has been successful in identifying more than 100 chloroplast envelope proteins, with approximately 80% confirmed to be located in the chloroplast envelope. Proteins involved in ion and metabolite transport, components of protein import machinery, and proteins involved in chloroplast lipid metabolism have been identified using these methods .

How can recombinant cemA be utilized as a research tool for studying chloroplast membrane transport?

Recombinant cemA can serve as a valuable research tool:

  • Transport studies:

    • Reconstitution in liposomes to study potential transport activities

    • Electrophysiological characterization of channel/transporter properties

    • Assessment of substrate specificity and kinetics

  • Protein-protein interaction analysis:

    • Identification of interaction partners through pull-down assays

    • Investigation of complex formation with other envelope components

    • Study of dynamic interactions during development and stress

  • Structural biology applications:

    • Providing material for crystallization attempts

    • Cryo-electron microscopy studies of membrane complexes

    • Computational modeling of transport mechanisms

  • Antibody development:

    • Production of specific antibodies against cemA

    • Immunolocalization studies at tissue and subcellular levels

    • Quantification of cemA levels in different tissues and conditions

Recombinant proteins have been successfully used to study other chloroplast envelope proteins, like the 16-kDa outer envelope protein (Oep16) that interacts with the precursor of NADPH:protochlorophyllide oxidoreductase A (pPORA) during its import into chloroplasts .

What challenges exist in expressing and purifying functional cemA and how can they be overcome?

Expressing and purifying functional membrane proteins like cemA presents several challenges:

Challenge and Solution Matrix:

ChallengeSolutionMethodologyExpected Outcome
Protein misfoldingCodon optimizationAdjust to C+G content of ~63%Improved protein folding
Low expression levelsSignal peptide additionAddition of signal peptide for ER transportEnhanced yield (~54 μg/mg protein)
ER stress overloadUPR gene modulationKnockout or overexpress genes like CRT, PDI, IPIIncreased recombinant protein yield
Protein extraction difficultiesSpecialized extraction methodsOrganic solvent extraction, alkaline/saline treatmentsEfficient recovery of hydrophobic proteins
Maintaining native structureGentle solubilizationUse of appropriate detergents and buffer systemsPreservation of functional properties

Research has demonstrated that overexpression of certain genes (GST and IPI) can have positive effects on recombinant protein production in barley. The PDI knockout has been shown to affect protein body formation, with protein evenly distributed in the cells of the endosperm, which could impact cemA production strategies .

How can imaging techniques be applied to study cemA localization and dynamics in barley chloroplasts?

Advanced imaging approaches provide insights into cemA localization and dynamics:

  • Confocal microscopy techniques:

    • Immunofluorescence using anti-cemA antibodies

    • Fusion with fluorescent proteins for live-cell imaging

    • Co-localization studies with other chloroplast components

  • Super-resolution microscopy:

    • Structured illumination microscopy (SIM) for enhanced resolution

    • Single-molecule localization microscopy for precise positioning

    • Stimulated emission depletion (STED) microscopy for nanoscale imaging

  • Electron microscopy approaches:

    • Immunogold labeling for transmission electron microscopy

    • Correlative light and electron microscopy for functional insights

    • Cryo-electron tomography for 3D structural information

  • Dynamic imaging applications:

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility studies

    • Single-particle tracking of labeled cemA proteins

    • Time-lapse imaging during development and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.