Recombinant Hordeum vulgare Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, a standard method for bacterial-based protein synthesis . Key steps include:

  • Cloning: Insertion of the petB gene into a bacterial expression vector.

  • Induction: Growth optimization in defined media to maximize yield.

  • Purification: Likely employs affinity chromatography (e.g., Ni-NTA for His-tagged variants), though specific tags are not explicitly documented for the barley variant .

Comparison with Other Recombinant Cytochrome b6 Proteins

OrganismSourceTagPurityApplications
Prochlorothrix hollandicaE. coliHis>90% (SDS-PAGE) Structural studies, functional assays
Hordeum vulgareE. coliN/A*>85% (SDS-PAGE) Photosynthesis research, biotechnology

Tag type for barley variant not explicitly stated; His-tags are common in bacterial systems .

Role in Photosynthetic Electron Transport

Cytochrome b6 facilitates quinol oxidation and plastocyanin reduction, driving proton translocation across thylakoid membranes . In barley, the b6/f complex’s stability is influenced by subunit interactions, such as PetP’s role in anchoring the Rieske protein and modulating electron transport efficiency .

Experimental Findings

  • Stability and Turnover: The b6/f complex in plants has a lifetime of ~1 week, with degradation linked to senescence . Recombinant variants may enable studies on protein turnover dynamics.

  • Subunit Interactions: Cross-linking studies in cyanobacteria reveal PetP binds to PetD, stabilizing the complex . Similar interactions in barley remain unexplored but are critical for functional assays.

  • Heterologous Expression in Barley: While not directly tested for petB, barley’s seed storage proteins (e.g., B-hordein) are being engineered to produce recombinant proteins like human EGF, suggesting potential for petB expression in transgenic barley .

Challenges and Future Directions

  • Partial Sequence Limitations: The recombinant barley petB lacks full-length characterization, potentially limiting functional studies .

  • Complex Assembly: Reconstituting the b6/f complex in vitro requires co-expression or co-purification with PetA, PetC, and PetD .

  • Biotechnological Applications: Leveraging barley’s seed-based production systems (as in EGF studies ) could enhance petB yield for industrial use.

Table 1: Key Subunits of the Cytochrome b6/f Complex

SubunitFunctionReactivity in Barley
PetACytochrome f (plastocyanin reduction)Probed via antibodies
PetBCytochrome b6 (quinol oxidation)Recombinant variant available
PetCRieske Fe-S protein (electron transfer)Anti-PetC antibodies validated
PetDSubunit IV (membrane anchoring)Essential for complex stability

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us; we will prioritize its inclusion.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is cytochrome b6 (petB) and what is its functional significance in photosynthesis?

Cytochrome b6, encoded by the petB gene, is a critical subunit of the cytochrome b6f complex located in the thylakoid membrane of chloroplasts. This integral membrane protein plays an essential role in photosynthetic electron transport by facilitating electron transfer between Photosystem II and Photosystem I. The cytochrome b6f complex serves as an electronic connection between the two photosystems and contributes to the formation of a proton gradient across the thylakoid membrane that drives ATP synthesis. In Chlamydomonas reinhardtii, research has shown that the petB gene encodes the cytochrome b6 subunit, which forms a precomplex with subunit IV (PetD) that is essential for the assembly of the complete cytochrome b6f complex .

The functional significance of cytochrome b6 extends beyond its electron transport role. Recent research demonstrates that the C-terminus of the cytochrome b6 subunit in Chlamydomonas reinhardtii is involved in regulating state transitions - the process that balances energy distribution between Photosystem I and II in response to changing light conditions. This regulation involves a phosphorylation cascade initiated by the reduction of the plastoquinone pool, activation of the STT7 protein kinase by the cytochrome b6f complex, and subsequent phosphorylation and migration of light-harvesting complexes .

What are the molecular characteristics of cytochrome b6 (petB) in Hordeum vulgare?

In Hordeum vulgare (barley), cytochrome b6 shares structural similarities with other plant species while maintaining species-specific characteristics. The protein contains multiple heme groups that participate in electron transfer reactions. Based on research in related species, cytochrome b6 from barley likely contains heme b molecules with specific coordination by conserved amino acid residues. In Arabidopsis thaliana, the PetB protein is encoded by the chloroplast genome (ATCG00720) and functions as part of the thylakoid membrane .

The expected molecular weight of the mature cytochrome b6 protein is approximately 17-25 kDa, with variations depending on post-translational modifications. Antibodies raised against the N-terminal region of cytochrome b6 from Arabidopsis thaliana show cross-reactivity with proteins from multiple species including Chlamydomonas reinhardtii, Echinochloa crus-galli, Marchantia polymorpha, Medicago sativa, Nannochloropsis oceanica, Panicum miliaceum, Pisum sativum, and Zea mays . This cross-reactivity suggests conservation of structural features across diverse plant species, including Hordeum vulgare.

How is recombinant cytochrome b6 (petB) typically expressed and purified for research purposes?

The expression and purification of recombinant cytochrome b6 presents significant challenges due to its membrane-associated nature and the presence of cofactors like heme groups. Researchers typically employ specialized expression systems that allow for proper folding and cofactor incorporation. For instance, when studying AIR12 (a cytochrome b protein), researchers have successfully used recombinant expression systems to produce functional protein for biochemical characterization .

For purification, a multi-step approach is typically employed:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents that maintain protein structure

  • Affinity chromatography utilizing engineered tags or antibodies specific to cytochrome b6

  • Size exclusion or ion exchange chromatography for further purification

Protein quality and functionality can be verified through spectroscopic methods that detect the characteristic absorption spectra of heme-containing cytochromes. Additionally, redox potential measurements through potentiometric titrations help confirm proper folding and cofactor incorporation. For example, in studies of cytochrome b proteins from other species, researchers have performed potentiometric redox titrations and determined midpoint redox potentials that indicate functional incorporation of heme groups .

How does the C-terminal domain of cytochrome b6 influence complex assembly and state transitions?

The C-terminal domain of cytochrome b6 plays a critical role in both the assembly of the cytochrome b6f complex and the regulation of state transitions. Recent research with Chlamydomonas reinhardtii has revealed that modifications to the C-terminus of the cytochrome b6 subunit significantly impact protein function and complex stability. Site-directed mutagenesis studies involving truncation (removal of L215b6) or elongation (addition of G216b6) of the cytochrome b6 C-terminus demonstrated that these modifications resulted in complexes that lacked heme ci and were subsequently degraded by the FTSH protease .

These findings highlight the importance of salt bridge formation between cytochrome b6 (PetB) and Subunit IV (PetD) for proper complex assembly. In double mutants where FTSH was inactivated, the modified cytochrome b6f complexes accumulated but had a non-functional phosphorylation cascade, preventing normal state transitions. Additionally, replacing the arginine residue (R207Kb6) that interacts with heme ci propionate resulted in a modified complex where heme ci was present, but the kinetics of phosphorylation were significantly slower .

The research revealed a complex mechanism where highly phosphorylated forms of the STT7 protein kinase accumulate transiently after reduction of the plastoquinone pool and represent the active forms of the kinase. This phosphorylation cascade ultimately leads to the phosphorylation of light-harvesting complex II (LHCII) targets and their migration toward Photosystem I, which is the limiting step for state transitions .

What heme coordination patterns are observed in cytochrome b6 and how do they affect redox properties?

Cytochrome b6 contains multiple heme groups with distinct coordination patterns that significantly influence their redox properties. Research on related cytochromes has provided insights into these coordination mechanisms. For instance, studies on the DOMON domain of cellobiose dehydrogenase from Phanerochaete chrysosporium revealed a single high-potential heme b (Em7 +164 mV) coordinated by methionine (Met-65) and histidine (His-163) residues .

Similar coordination patterns are likely present in cytochrome b6, with conserved methionine and histidine residues (such as Met-91 and His-176 in some homologs) serving as axial ligands for heme b molecules. This Met-His coordination is characteristic of high-potential heme groups and results in distinct spectroscopic properties, including a highly anisotropic low-spin (HALS) species with g = 3.3 in EPR spectra .

The redox properties of cytochrome b6 are further characterized by potentiometric titrations. Research on related cytochromes has revealed complex redox behavior, with evidence for multiple redox centers with distinct midpoint potentials. For example, some plant cytochrome b preparations show two apparent midpoint redox potentials at approximately +135 and +180/+204 mV. These different potentials reflect the diverse electron transfer roles of the protein within the photosynthetic electron transport chain .

How does cytochrome b6 interact with the STT7/STN7 kinase to regulate state transitions?

The interaction between cytochrome b6 and the STT7/STN7 kinase represents a critical regulatory mechanism for state transitions in photosynthetic organisms. Recent research demonstrates that specific structural elements of cytochrome b6, particularly its C-terminal domain, are essential for proper STT7 activation .

The activation mechanism involves multiple steps:

  • Reduction of the plastoquinone pool under changing light conditions

  • Interaction of reduced plastoquinone with the Qo site of the cytochrome b6f complex

  • Conformational changes in cytochrome b6 that enable interaction with STT7

  • Phosphorylation and activation of STT7

  • Subsequent phosphorylation of LHCII proteins by activated STT7

Evidence from Chlamydomonas reinhardtii shows that highly phosphorylated forms of STT7 accumulate transiently after reduction of the plastoquinone pool and represent the active forms of the protein kinase. The phosphorylation of LHCII targets is favored at the expense of the protein kinase, and the migration of LHCII toward PSI is the limiting step for state transitions .

Mutations in the C-terminal region of cytochrome b6 disrupt this regulatory pathway. For example, modified cytochrome b6f complexes with alterations to the C-terminus accumulated in double mutants where FTSH was inactivated, but the phosphorylation cascade was blocked, preventing normal state transitions .

What antibody-based approaches are effective for detecting recombinant cytochrome b6 in experimental systems?

Antibody-based detection of recombinant cytochrome b6 is a crucial methodology for monitoring protein expression, localization, and complex assembly. Several validated antibodies have demonstrated effectiveness in detecting cytochrome b6 across multiple species, suggesting their utility for Hordeum vulgare research.

Polyclonal antibodies raised against the N-terminal region of cytochrome b6 have shown broad cross-reactivity across plant species. For example, antibodies developed against the N-terminal region of Arabidopsis thaliana PetB (ATCG00720) have demonstrated reactivity with proteins from multiple species including Chlamydomonas reinhardtii, Echinochloa crus-galli, Marchantia polymorpha, and cereals like Zea mays . These antibodies are particularly effective for Western blot applications at dilutions of approximately 1:1000.

For experimental considerations, researchers should note:

Antibody ApplicationRecommended DilutionExpected MWSpecies Cross-Reactivity
Western blot1:100017-25 kDaMultiple plant species
Immunolocalization1:100 to 1:500N/ACase-specific testing required

When designing experiments, it's important to include appropriate controls for antibody specificity validation. Wild-type samples alongside known positive and negative controls help confirm the identity of detected proteins. Additionally, using antibodies against other subunits of the cytochrome b6f complex (such as cytochrome f or PetD) can provide complementary evidence for complex assembly .

How can researchers effectively use mutagenesis to study cytochrome b6 function?

Site-directed mutagenesis of the petB gene represents a powerful approach for investigating structure-function relationships in cytochrome b6. This methodology has been successfully applied in model organisms like Chlamydomonas reinhardtii to elucidate critical functional domains and residues.

Effective mutagenesis strategies for studying cytochrome b6 include:

  • C-terminal modifications: Research has demonstrated that altering the C-terminus through truncation (removing L215b6) or elongation (adding G216b6) can reveal the importance of this region for complex assembly and function. These modifications have been shown to affect heme ci incorporation and protein stability .

  • Targeted substitution of conserved residues: Replacing specific amino acids involved in heme coordination or protein-protein interactions can provide insights into functional mechanisms. For example, substitution of an arginine residue (R207Kb6) that interacts with heme ci propionate resulted in altered phosphorylation kinetics .

  • Domain swapping: Replacing domains of cytochrome b6 with corresponding regions from related proteins can help identify species-specific functional elements.

When implementing these approaches, researchers should carefully consider:

  • The genetic background of the host organism (chloroplast transformation methods may be required)

  • The need for complementary biochemical and biophysical analyses to characterize mutant phenotypes

  • Potential compensatory mechanisms that may mask mutant effects

  • The importance of quantitative measurements of photosynthetic parameters

What spectroscopic methods are most informative for characterizing recombinant cytochrome b6?

Spectroscopic methods are essential for characterizing the structural integrity and functional properties of recombinant cytochrome b6. Several techniques provide complementary information about different aspects of the protein's properties:

  • UV-Visible Absorption Spectroscopy: This fundamental technique detects the characteristic absorption bands of heme-containing proteins. Reduced and oxidized cytochrome b6 display distinctive spectra with absorption maxima at specific wavelengths. The α-band (550-560 nm region) is particularly informative for monitoring redox state changes. Difference spectra between reduced and oxidized forms can be used to quantify the cytochrome content .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: EPR provides valuable information about the coordination environment of heme groups. Cytochromes with Met-His coordination typically display highly anisotropic low-spin (HALS) signals with characteristic g-values. For example, EPR spectra showing a HALS species with g = 3.3 are compatible with His-Met coordinated heme, similar to signals reported for cellobiose dehydrogenase .

  • Potentiometric Redox Titrations: This approach determines the midpoint redox potentials of electron transfer cofactors. Research on related cytochromes has revealed complex redox behavior with multiple midpoint potentials (e.g., +135 and +204 mV), reflecting different heme environments. These measurements provide crucial information about the protein's functional state and electron transfer capabilities .

  • Circular Dichroism (CD) Spectroscopy: CD spectroscopy in both the far-UV and visible regions provides information about protein secondary structure and the environment of the heme groups, respectively.

When applying these methods to recombinant cytochrome b6 from Hordeum vulgare, researchers should carefully control experimental conditions such as pH, temperature, and salt concentration, which can significantly affect spectroscopic properties and redox potentials.

What are the common challenges in expressing functional recombinant cytochrome b6?

Expressing functional recombinant cytochrome b6 presents several challenges due to its membrane-associated nature, cofactor requirements, and complex assembly needs. Researchers frequently encounter obstacles that must be systematically addressed:

  • Membrane protein expression difficulties: As an integral membrane protein, cytochrome b6 contains hydrophobic domains that can cause misfolding, aggregation, or inclusion body formation in conventional expression systems. Specialized expression hosts with enhanced membrane protein folding capabilities may be required .

  • Heme incorporation: Functional cytochrome b6 requires proper incorporation of heme groups with specific coordination. Expression systems must provide adequate heme synthesis pathways and appropriate redox environments to facilitate correct cofactor insertion .

  • Complex assembly requirements: In vivo, cytochrome b6 forms a stable complex with other subunits like PetD (Subunit IV). Research has demonstrated that salt bridge formation between cytochrome b6 (PetB) and Subunit IV (PetD) is essential for complex stability. Failed complex formation can lead to protein degradation by proteases like FTSH .

  • Post-translational modifications: Recombinant systems may not properly reproduce native post-translational modifications that affect protein stability or function.

Approaches to overcome these challenges include:

  • Using specialized membrane protein expression systems

  • Co-expression with interacting partners

  • Supplementing growth media with heme precursors

  • Expressing truncated or chimeric constructs that maintain functional domains while improving expression characteristics

  • Engineering affinity tags that minimize interference with protein function

How can researchers validate the functionality of recombinant cytochrome b6?

Validating the functionality of recombinant cytochrome b6 requires multiple complementary approaches that assess different aspects of protein structure and activity:

  • Spectroscopic analysis: Properly folded cytochrome b6 with correctly incorporated heme groups displays characteristic absorption spectra. The reduced minus oxidized difference spectrum provides a distinctive fingerprint that confirms heme incorporation. Additionally, EPR spectroscopy can verify proper heme coordination through characteristic g-values associated with specific coordination environments .

  • Redox potential measurements: Potentiometric titrations determine whether the recombinant protein exhibits appropriate midpoint redox potentials. Functional cytochrome b6 should display redox potentials consistent with its role in electron transport (typically in the range of +100 to +250 mV) .

  • Complex formation assessment: The ability of recombinant cytochrome b6 to interact with other components of the cytochrome b6f complex, particularly PetD (Subunit IV), can be evaluated through co-immunoprecipitation, crosslinking studies, or native gel electrophoresis. Salt bridge formation between cytochrome b6 and Subunit IV is essential for complex stability .

  • Functional complementation: For the most definitive validation, recombinant cytochrome b6 can be tested for its ability to restore photosynthetic electron transport in systems lacking endogenous cytochrome b6, such as petB mutants. This approach provides direct evidence of functional activity in a physiologically relevant context .

  • State transition assays: Since cytochrome b6 plays a role in regulating state transitions, assessing the ability of recombinant protein to support proper STT7 kinase activation and LHCII phosphorylation provides functional validation .

How might advances in structural biology enhance our understanding of cytochrome b6 function?

Recent advances in structural biology techniques offer unprecedented opportunities to elucidate the detailed molecular mechanisms of cytochrome b6 function in Hordeum vulgare and other plant species. Several emerging approaches hold particular promise:

  • Cryo-electron microscopy (cryo-EM): The "resolution revolution" in cryo-EM now enables high-resolution structural determination of membrane protein complexes in near-native environments. Applied to the cytochrome b6f complex, this technique could reveal dynamic conformational changes associated with electron transport and interactions with partner proteins like STT7 kinase .

  • Integrative structural biology: Combining multiple techniques such as X-ray crystallography, NMR spectroscopy, and computational modeling can provide comprehensive structural insights that no single method can achieve. This approach is particularly valuable for understanding how the cytochrome b6f complex interacts with plastoquinone and other components of the electron transport chain.

  • Time-resolved spectroscopy: Advanced techniques like time-resolved X-ray absorption spectroscopy can capture transient states during electron transfer, providing insights into the dynamic aspects of cytochrome b6 function that are inaccessible to static structural methods.

Future structural studies could focus on several key areas:

  • Conformational changes in cytochrome b6 associated with plastoquinone binding

  • Structural basis for the interaction between cytochrome b6 and STT7 kinase

  • Species-specific structural features of Hordeum vulgare cytochrome b6

  • The role of specific amino acid residues in determining redox properties

What is the potential impact of understanding cytochrome b6 function on crop improvement strategies?

Understanding the molecular details of cytochrome b6 function in Hordeum vulgare has significant implications for developing strategies to enhance photosynthetic efficiency and stress tolerance in barley and related crops:

  • Photosynthetic efficiency: Cytochrome b6 plays a central role in photosynthetic electron transport and energy distribution between photosystems. Research into its structure-function relationships could identify genetic variants with enhanced electron transfer properties or improved regulatory control. Small improvements in photosynthetic efficiency can translate to significant yield increases at the field scale .

  • Photoprotection mechanisms: The cytochrome b6f complex is involved in regulatory processes that protect plants from photodamage under fluctuating light conditions. Enhanced understanding of how cytochrome b6 participates in state transitions and other regulatory mechanisms could lead to crops with improved resilience to variable light environments .

  • Stress tolerance: Photosynthetic electron transport is particularly vulnerable to various environmental stresses. Identifying variants of cytochrome b6 with improved stability or function under stress conditions could contribute to developing crops with enhanced tolerance to environmental challenges.

  • Directed evolution approaches: With detailed knowledge of structure-function relationships, directed evolution techniques could be applied to cytochrome b6 to select for improved properties. This approach could accelerate the development of crops with enhanced photosynthetic capabilities beyond what conventional breeding might achieve.

  • Synthetic biology applications: Understanding the modular nature of cytochrome b6 function could enable the design of synthetic electron transport components with novel properties, potentially opening new avenues for engineering crop metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.