Recombinant Hordeum vulgare Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Introduction to DAD1 Proteins

Defender against apoptotic cell death 1 (DAD1) was initially identified as a negative regulator of programmed cell death in a temperature-sensitive hamster cell line. When mutated, the affected cells underwent apoptosis at restrictive temperatures, revealing DAD1's crucial role in cellular survival . This protein has since been discovered across numerous species, from yeast to humans, with remarkably conserved sequences and functions .

In multicellular organisms, DAD1 serves as an essential regulator of development and cellular homeostasis. Studies in mice demonstrated that DAD1 mutations lead to developmental delays, morphological abnormalities, increased cell apoptosis during embryogenesis, and embryonic lethality by midgestation . These findings underscore DAD1's fundamental importance in normal development across higher organisms, including plants like Hordeum vulgare (barley).

Protein Structure and Conservation

Hordeum vulgare DAD1 belongs to a highly conserved family of proteins involved in cellular survival. The DAD1 protein in barley shows significant sequence homology with other species, particularly maintaining over 70% identity with human DAD1 . This striking conservation across evolutionary distant organisms reflects the protein's fundamental biological importance.

DAD1 functions as a subunit of the oligosaccharyltransferase (OST) complex, which is critical for N-linked glycosylation of proteins in the endoplasmic reticulum (ER). This post-translational modification process is essential for proper protein folding, stability, and function .

Genomic Organization

While the search results don't provide specific details about the genomic organization of barley DAD1, research in other organisms indicates that DAD1 genes typically contain multiple exons and are subject to transcriptional regulation in response to developmental and environmental cues. In barley, genetic studies have advanced significantly with the development of high-quality reference transcript datasets such as BaRTv1.0, which enables precise quantification of gene expression and alternative splicing analyses .

N-Glycosylation Regulation

The primary function of DAD1 in barley, as in other organisms, is facilitating protein N-glycosylation in the endoplasmic reticulum. As an integral subunit of the oligosaccharyltransferase complex, DAD1 contributes to the attachment of oligosaccharide chains to newly synthesized proteins . This process is crucial for proper protein folding and cellular function.

Studies in diverse organisms have demonstrated that DAD1 deletion leads to significant defects in N-glycosylation, resulting in accumulation of unfolded or misfolded proteins in the ER . This accumulation triggers ER stress and activates the unfolded protein response (UPR), which can ultimately lead to programmed cell death if the stress cannot be resolved .

Cell Death Regulation

DAD1's role in regulating programmed cell death appears to be conserved in barley. Research indicates that DAD1 functions as a suppressor of apoptotic-like processes in plant cells, similar to its role in animal systems . This function is particularly important during plant development and in response to biotic and abiotic stresses.

In barley, the expression of DAD1 homologues has been observed in response to pathogen challenge, specifically in interactions with the powdery mildew fungus Blumeria graminis f.sp. hordei (Bgh) . Studies suggest that BI-1 (BAX inhibitor 1), another cell death suppressor protein in barley, may function in pathways overlapping with DAD1 to regulate defense responses and cell survival during pathogen attack .

Pathogen Defense Mechanisms

Research indicates that DAD1 plays an important role in plant immune responses. In barley, differential expression of cell death regulators, including proteins like DAD1, has been observed in response to pathogen challenge . These regulators appear to coordinate cell survival and death decisions during plant-pathogen interactions.

Studies on related cell death suppressors in barley, such as BAX inhibitor 1 (BI-1), have shown that they can modulate defense responses against powdery mildew fungus (Blumeria graminis) . The expression of these cell death regulators correlates with both early defense mechanisms in resistant barley varieties and with pathogen development in susceptible varieties, suggesting a complex role in plant immunity .

Stress Signaling Pathways

The loss of DAD1 function triggers multiple stress signaling pathways, most notably the unfolded protein response (UPR) and c-Jun N-terminal kinase (JNK) pathways. Research in model organisms has demonstrated that DAD1 deficiency leads to ER stress due to accumulated unfolded or misfolded hypoglycosylated proteins .

This ER stress activates UPR signaling, which precedes the activation of JNK signaling . The JNK pathway, in turn, mediates cell apoptosis. Interestingly, studies have shown that blocking the JNK pathway in DAD1-deficient tissues can suppress cell apoptosis and partially restore organ size, highlighting the mechanistic link between DAD1 function and cell survival .

Research Applications

Recombinant DAD1 proteins serve valuable purposes in research settings, including:

  1. Functional studies of programmed cell death mechanisms

  2. Investigation of stress response pathways in plants

  3. Analysis of protein N-glycosylation processes

  4. Development of crop protection strategies

  5. Comparative studies across species to understand evolutionary conservation

Evolutionary Conservation

DAD1 proteins display remarkable evolutionary conservation across different kingdoms of life. The yeast homolog of DAD1, known as Ost2, shares approximately 40% sequence identity with hamster DAD1, and mutations in this gene induce yeast cell apoptosis . Similarly, the Drosophila homolog (dDad1) shows more than 70% identity with human DAD1 .

This high degree of conservation underscores the fundamental importance of DAD1 in eukaryotic cells and suggests that insights gained from studying DAD1 in one organism may have broad applicability across species.

Comparative Functions

Table 1: Comparison of DAD1 Functions Across Species

SpeciesProtein NameSequence Identity to Human DAD1Primary FunctionsPhenotype of Loss-of-Function
Hordeum vulgare (Barley)DAD1High (>70% presumed)N-glycosylation, cell death suppressionIncreased apoptosis, developmental defects
Saccharomyces cerevisiae (Yeast)Ost2~40%N-glycosylationCell apoptosis
Drosophila melanogasterdDad1>70%N-glycosylation, tissue growth regulationReduced tissue growth, increased apoptosis
Mus musculus (Mouse)Dad1Very highN-glycosylation, embryonic developmentDevelopmental delay, embryonic lethality
Homo sapiens (Human)DAD1100% (reference)N-glycosylation, cell survivalAssociated with various diseases

N-Glycosylation Pathway

As a subunit of the oligosaccharyltransferase (OST) complex, DAD1 participates in the co-translational transfer of oligosaccharide precursors to nascent polypeptides in the endoplasmic reticulum. This N-glycosylation process is critical for proper protein folding and quality control .

Loss of DAD1 function compromises the efficiency of N-glycosylation, leading to accumulation of unfolded or misfolded proteins in the ER . This protein burden triggers ER stress and activates cellular stress response pathways.

Cell Death Regulation Mechanisms

Several possible mechanisms have been proposed for how DAD1 prevents cell death:

  1. By ensuring proper N-glycosylation of specific proteins crucial for cell survival

  2. By preventing ER stress through its role in protein processing

  3. Through possible direct interactions with apoptosis regulators

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
Target Protein Sequence
MPKAAGDAKLLIQSLNKAYAATPTNLKIIDLYVVFAVVTALLQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCHRIQVNKDNKEFKDLAPERAFADFVLCSLVLHLVIMNFLG
Uniprot No.

Target Background

Function
Defender against cell death 1 (DAD1) is a subunit of the oligosaccharyl transferase (OST) complex, which catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process constitutes the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Database Links

UniGene: Hv.92

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Defender Against Cell Death 1 (DAD1) and its role in plants?

DAD1 was initially identified as a mammalian apoptosis suppressor protein, but has conserved orthologs in plants that function as negative regulators of programmed cell death (PCD) . In plants, DAD1 proteins are integral components of the endoplasmic reticulum (ER) membrane and play crucial roles in both development and stress responses . Plant DAD1 orthologs from model organisms such as Arabidopsis thaliana and rice have demonstrated the ability to rescue hamster tsBN7 cells from apoptosis, confirming their function as cell death repressors .

DAD1 appears to be functionally conserved across diverse organisms, including unicellular eukaryotes like Chlamydomonas reinhardtii where DAD1 homologues show downregulation during UV-induced programmed cell death . This conservation suggests a fundamental role in regulating cellular viability that predates the evolution of multicellularity.

How does barley DAD1 compare structurally to DAD1 in other organisms?

While the search results don't provide specific structural information about barley DAD1, research on DAD1 proteins across species suggests a highly conserved structure. DAD1 is typically a small protein (around 115 amino acids) containing multiple transmembrane domains that anchor it to the ER membrane .

The high degree of sequence conservation allows plant DAD1 proteins to functionally replace mammalian DAD1, as demonstrated by complementation studies . This structural conservation likely extends to barley DAD1, though species-specific variations may confer unique properties related to crop-specific stress responses.

Similar to HvGR-RBP1 (another barley protein), HvDAD1 likely contains structural domains that are well-preserved across plant species, with potential barley-specific adaptations in regulatory regions that might influence expression patterns under specific environmental conditions .

What are the key molecular characteristics of Hordeum vulgare DAD1?

Hordeum vulgare DAD1 likely shares key characteristics with DAD1 proteins from other plant species, including:

  • Subcellular localization: Based on data from soybean DAD1 (GmDAD1), barley DAD1 is likely localized to the endoplasmic reticulum (ER) membrane .

  • Function in N-glycosylation: DAD1 proteins are subunits of the oligosaccharyltransferase (OST) complex involved in protein N-glycosylation .

  • Expression patterns: DAD1 genes typically show differential expression patterns under stress conditions and during developmental processes. In soybean, DAD1 expression is induced by pathogen infection .

  • Molecular weight: Plant DAD1 proteins are generally small, with molecular weights around 12-13 kDa .

  • Protein interaction network: DAD1 likely interacts with components of the ER stress signaling pathway and may influence the expression of multiple defense-related genes, similar to what has been observed with GmDAD1 .

What are the optimal conditions for expressing recombinant HvDAD1 in barley systems?

For optimal expression of recombinant HvDAD1 in barley systems, researchers should consider the following approach:

Barley Seed-Based Expression System:
Barley seeds provide an excellent platform for recombinant protein expression due to their natural protein production and storage capabilities . For HvDAD1 expression:

  • Promoter selection: Use endosperm-specific promoters to direct protein expression to the seed compartment, which provides natural protein storage capabilities .

  • Transformation method: Agrobacterium-mediated transformation has been successful for introducing genes into barley, as demonstrated with other recombinant proteins .

  • Growth conditions: Controlled greenhouse conditions with appropriate temperature (18-22°C), light intensity, and photoperiod are essential for optimal protein accumulation in developing seeds.

  • Harvest timing: The developmental stage of the barley seed significantly affects recombinant protein yields. Harvesting at the appropriate stage is critical for maximum protein recovery.

The barley expression system offers several advantages for recombinant DAD1 production:

  • Natural protein machinery capable of proper folding and post-translational modifications

  • Long-term, stable protein storage in seeds without degradation

  • Scalability through standard agricultural practices

  • Biological containment due to self-pollinating nature

How can researchers efficiently extract and purify recombinant HvDAD1 from barley?

Efficient extraction and purification of recombinant HvDAD1 from barley requires specialized protocols to account for its membrane-associated nature:

Extraction Protocol:

  • Seed preparation: Mill mature barley seeds to fine powder under cold conditions to prevent protein degradation.

  • Membrane protein solubilization: Use a buffer containing mild detergents (e.g., 1% Triton X-100 or CHAPS) to solubilize membrane-bound DAD1.

  • Extraction buffer composition: Include protease inhibitors, reducing agents (e.g., DTT), and appropriate pH buffers (typically pH 7.0-8.0) to maintain protein stability.

Purification Strategy:

  • Affinity chromatography: If HvDAD1 is expressed with an affinity tag (His-tag, FLAG-tag), use corresponding affinity resins.

  • Size exclusion chromatography: Separate DAD1 from other proteins based on molecular weight, which also helps remove detergent micelles.

  • Ion exchange chromatography: Further purify based on charge characteristics.

This multi-step purification process would be similar to methods used for other recombinant proteins expressed in barley seed systems, with modifications specific to membrane protein handling .

What technical challenges are common when working with recombinant barley DAD1?

Researchers working with recombinant barley DAD1 face several technical challenges:

  • Membrane protein solubilization: As an ER-localized protein, DAD1 contains transmembrane domains that make extraction and maintaining solubility difficult . Finding the optimal detergent type and concentration is critical.

  • Maintaining native conformation: Preserving the native folding and activity of DAD1 during extraction and purification requires careful optimization of buffer conditions.

  • Expression levels: Achieving high expression levels may be challenging, requiring optimization of promoters and codon usage for barley systems.

  • Functional assays: Developing reliable assays to confirm the activity of recombinant DAD1 is challenging given its role in complex cellular processes like programmed cell death regulation .

  • Protein-protein interactions: Studying interactions between DAD1 and other proteins in the ER stress pathway requires specialized techniques that can detect transient or membrane-associated interactions .

  • Post-translational modifications: Ensuring proper post-translational modifications that may be critical for DAD1 function requires careful characterization of the recombinant protein.

How does HvDAD1 function in programmed cell death pathways in barley?

Based on studies of DAD1 in other plants, HvDAD1 likely functions as a negative regulator of programmed cell death (PCD) in barley through several mechanisms:

  • ER stress regulation: DAD1 appears to be involved in endoplasmic reticulum stress signaling pathways that can trigger PCD when activated. In soybean, GmDAD1 affects the expression of multiple defense-related genes through this pathway .

  • N-glycosylation: As a component of the oligosaccharyltransferase (OST) complex, DAD1 participates in protein N-glycosylation, which is essential for proper protein folding and function. Disruption of this process can lead to ER stress and PCD .

  • Protein interaction network: DAD1 likely interacts with other proteins involved in cell death regulation. In mammals, DAD1 interacts with Mcl1, a Bcl2-family protein that inhibits apoptosis, suggesting DAD1 may also regulate cell viability through protein-protein interactions independently of its OST function .

As observed in Chlamydomonas reinhardtii, downregulation of DAD1 is associated with the onset of programmed cell death after UV exposure, further supporting its role as a cell death suppressor . Similar mechanisms likely operate in barley, though the specific triggers and downstream pathways may differ based on crop-specific adaptations.

What role does HvDAD1 play in stress response mechanisms?

HvDAD1 likely plays crucial roles in barley stress response mechanisms, particularly through:

  • Abiotic stress tolerance: In other plants, DAD1 has been implicated in responses to various abiotic stresses including UV radiation . In Chlamydomonas, DAD1 downregulation occurs during UV-induced cell death , suggesting that DAD1 expression levels may be modulated as part of stress response pathways.

  • Pathogen resistance: Studies in soybean showed that GmDAD1 expression is induced by Phytophthora infection in both compatible and incompatible soybean varieties, with higher transcript accumulation correlating with enhanced resistance levels . This suggests HvDAD1 may similarly contribute to pathogen resistance in barley.

  • ER stress response: DAD1 participates in ER stress signaling, which is activated during various environmental stresses. In soybean, GmDAD1 affects the expression of multiple defense-related genes, including those encoding pathogenesis-related (PR) proteins .

  • Cold stress response: Similar to barley HvGR-RBP1, which functions like cold-shock proteins and has RNA chaperone activity , HvDAD1 may also be involved in cold stress responses, though through different molecular mechanisms.

  • Senescence regulation: In Gladiolus, DAD1 expression decreases during petal senescence , suggesting a role in regulating tissue aging. HvDAD1 may similarly influence senescence processes in barley.

How can recombinant HvDAD1 be utilized in plant pathogen resistance studies?

Recombinant HvDAD1 offers several applications in plant pathogen resistance studies:

  • Resistance mechanism investigation: Purified HvDAD1 can be used to study molecular interactions with pathogen effectors or host defense components, illuminating resistance mechanisms similar to those observed with GmDAD1 in soybean-Phytophthora interactions .

  • Transgenic studies: Based on findings with GmDAD1, where transcript accumulations positively correlated with resistance to Phytophthora , recombinant HvDAD1 could be used in transgenic approaches to enhance barley resistance to fungal pathogens.

  • Protein-protein interaction assays: Recombinant HvDAD1 enables identification of interacting partners in defense signaling cascades through techniques like co-immunoprecipitation, yeast two-hybrid assays, or pull-down experiments.

  • Structural studies: Purified recombinant HvDAD1 allows structural characterization to understand how pathogen infection might affect its conformation or function.

  • Comparative studies: Recombinant HvDAD1 can be compared with DAD1 proteins from other species (like GmDAD1) to identify conserved and unique features that contribute to pathogen resistance, potentially revealing barley-specific defense mechanisms .

How does post-translational modification affect HvDAD1 function in stress responses?

Post-translational modifications (PTMs) likely play critical roles in regulating HvDAD1 function during stress responses:

  • Phosphorylation sites: Phosphorylation may regulate DAD1 activity or its interaction with other proteins in stress signaling pathways. Analysis of potential phosphorylation sites using bioinformatic tools can identify regulatory motifs that respond to stress-activated kinases.

  • N-glycosylation: Although DAD1 participates in the N-glycosylation of other proteins, it may itself be subject to glycosylation that affects its stability or function during stress conditions.

  • Ubiquitination: Stress conditions might trigger ubiquitination of DAD1, leading to its degradation and subsequent activation of cell death pathways. This would be consistent with the observation that DAD1 downregulation occurs during programmed cell death in Chlamydomonas .

Methodological approaches to study these PTMs include:

  • Mass spectrometry analysis of purified recombinant HvDAD1 under different stress conditions

  • Site-directed mutagenesis of predicted modification sites to assess functional consequences

  • In vitro modification assays using stress-activated enzymes

  • Immunoprecipitation followed by western blotting with PTM-specific antibodies

Understanding these modifications would provide insights into how plants fine-tune DAD1 activity during stress responses and could identify potential targets for enhancing stress tolerance in crops.

What interactions occur between HvDAD1 and other proteins in the ER stress pathway?

HvDAD1 likely engages in multiple protein interactions within the ER stress pathway:

  • OST complex components: As part of the oligosaccharyltransferase complex, DAD1 interacts with other OST subunits to facilitate N-glycosylation of nascent proteins .

  • ER stress sensors: DAD1 may interact with ER stress sensors like IRE1, PERK, or ATF6 homologs, modulating their activation during stress conditions.

  • Unfolded protein response (UPR) components: Interactions with chaperones like BiP/GRP78 or co-chaperones could influence protein folding capacity and ER stress resolution.

  • Cell death regulators: Similar to mammalian DAD1's interaction with the anti-apoptotic protein Mcl1 , HvDAD1 may interact with plant-specific cell death regulators such as BI-1 (BAX inhibitor-1) or BAG (Bcl-2-associated athanogene) proteins.

Experimental approaches to identify these interactions include:

  • Co-immunoprecipitation of tagged HvDAD1 followed by mass spectrometry

  • Yeast two-hybrid screening using HvDAD1 as bait

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

  • Protein microarrays to detect multiple potential interactions

A table summarizing predicted HvDAD1 protein interactions based on studies in other species:

Interaction PartnerPathwayFunctionDetection Method
OST subunitsN-glycosylationProtein modificationCo-IP, Mass spectrometry
BI-1Cell death regulationApoptosis inhibitionY2H, BiFC
ER chaperones (BiP)Protein foldingER stress resolutionCo-IP, Pull-down
IRE1UPR signalingStress sensingBiFC, FRET
PR proteinsDefense responsePathogen resistanceGenetic epistasis, Co-expression

How do genetic variations in HvDAD1 correlate with stress tolerance phenotypes?

Genetic variations in HvDAD1 likely contribute to differences in stress tolerance among barley varieties:

  • Allelic diversity: Natural variations in the HvDAD1 coding sequence may alter protein stability, activity, or interactions, potentially explaining differences in stress tolerance between barley cultivars.

  • Promoter polymorphisms: Variations in regulatory regions could affect HvDAD1 expression levels or stress-responsiveness, similar to how GmDAD1 expression is induced during pathogen infection .

  • Alternative splicing: Different splicing patterns may generate HvDAD1 isoforms with distinct functions under various stress conditions.

To investigate these correlations, researchers should:

  • Sequence HvDAD1 across diverse barley germplasm to identify single nucleotide polymorphisms (SNPs), insertions/deletions, or copy number variations.

  • Perform association studies correlating genetic variations with quantitative traits related to stress tolerance.

  • Develop functional markers based on significant associations for use in marker-assisted selection.

  • Conduct transgenic complementation studies with different HvDAD1 alleles to confirm phenotypic effects.

  • Analyze expression patterns of different HvDAD1 variants under stress conditions using methods similar to those used for GmDAD1 in soybean .

This approach parallels studies of HvGR-RBP1, where expression analysis following cold stress revealed functions similar to cold-shock proteins , and could identify valuable genetic resources for breeding stress-tolerant barley varieties.

What are the most effective protocols for analyzing HvDAD1 expression levels?

For accurate analysis of HvDAD1 expression levels, researchers should consider these optimized protocols:

  • Quantitative RT-PCR (qRT-PCR):

    • Design primers from conserved regions of the HvDAD1 gene, similar to the approach used for GmDAD1

    • Select appropriate reference genes for barley (e.g., genes similar to GmCons4 used in soybean studies )

    • Use the comparative 2^-ΔΔCT method for relative quantification

    • Implement statistical analysis using Student's t-test with significance threshold of p < 0.05

  • RNA-Seq analysis:

    • Extract high-quality total RNA from different tissues or stress-treated samples

    • Generate cDNA libraries following standard protocols

    • Perform deep sequencing (>20 million reads per sample)

    • Use specialized pipelines for membrane protein transcript analysis

    • Normalize expression data using appropriate methods (FPKM, TPM, or DESeq2)

  • Protein-level analysis:

    • Western blotting with specific antibodies against HvDAD1

    • Use appropriate extraction buffers containing detergents for membrane protein solubilization

    • Include proper controls (loading controls, positive/negative samples)

    • Quantify bands using densitometry software with statistical validation

  • In situ hybridization/immunohistochemistry:

    • Localize HvDAD1 expression in specific cell types or tissues

    • Use RNA probes or specific antibodies

    • Implement proper controls to validate specificity

Each method provides complementary information about HvDAD1 expression patterns under different conditions or developmental stages.

How can researchers design experiments to assess HvDAD1 activity in vivo?

To assess HvDAD1 activity in vivo, researchers can implement these experimental designs:

  • Gene silencing approaches:

    • RNAi-mediated silencing in barley hairy roots (similar to GmDAD1 silencing in soybean )

    • VIGS (virus-induced gene silencing) using appropriate viral vectors for monocots

    • CRISPR/Cas9-mediated knockout or knockdown

    • Analyze phenotypic effects on programmed cell death, stress responses, and pathogen resistance

  • Overexpression studies:

    • Generate transgenic barley lines overexpressing HvDAD1 under constitutive or inducible promoters

    • Assess impacts on stress tolerance and pathogen resistance

    • Compare with results from heterologous expression studies, such as GmDAD1 expression in N. benthamiana

  • Functional complementation assays:

    • Express HvDAD1 in dad1 mutants of model organisms (e.g., Arabidopsis, yeast)

    • Test rescue of cell death phenotypes under stress conditions

    • Similar to complementation studies with other plant DAD1 orthologs in hamster tsBN7 cells

  • Stress response assessment:

    • Challenge HvDAD1-modified plants with various stresses (pathogens, cold, UV, etc.)

    • Quantify stress tolerance parameters (lesion size, cell death markers, etc.)

    • Use methods similar to those employed for P. sojae infection studies in soybean

  • Fluorescent reporter systems:

    • Create fusion proteins with fluorescent tags to track HvDAD1 localization

    • Use FRET or BiFC to monitor protein-protein interactions in vivo

    • Utilize subcellular markers (like mCherry-HDEL for ER ) to confirm localization

These approaches provide comprehensive insights into HvDAD1 function while controlling for variables that might influence results.

What bioinformatic approaches are recommended for analyzing HvDAD1 sequence data?

Comprehensive bioinformatic analysis of HvDAD1 sequence data should include:

  • Sequence homology and phylogenetic analysis:

    • Multiple sequence alignment with DAD1 proteins from diverse species

    • Phylogenetic tree construction to understand evolutionary relationships

    • Identification of conserved domains and barley-specific features

  • Structural prediction and analysis:

    • Transmembrane domain prediction using specialized algorithms

    • 3D structure modeling based on homology to known structures

    • Molecular dynamics simulations to understand conformational dynamics

    • Similar to the structural analysis performed for barley HvGR-RBP1

  • Promoter analysis:

    • Identification of cis-regulatory elements using plant promoter databases

    • Comparison with stress-responsive promoters from other species

    • Prediction of transcription factor binding sites

  • Expression data mining:

    • Analysis of publicly available barley transcriptome data

    • Co-expression network construction to identify functionally related genes

    • Integration with stress response datasets

  • Functional annotation and pathway analysis:

    • GO term enrichment analysis

    • KEGG pathway mapping

    • Protein-protein interaction network prediction

    • Integration with data on programmed cell death and stress response pathways

  • Genetic variation analysis:

    • SNP identification across barley germplasm

    • Haplotype analysis and association with phenotypic traits

    • Identification of functionally important polymorphisms

These bioinformatic approaches provide a foundation for experimental work by generating testable hypotheses about HvDAD1 function and regulation in barley stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.