Recombinant Hordeum vulgare Defender against cell death 2 (DAD2)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Origin

Defender against cell death 2 (DAD2) is a protein derived from Hordeum vulgare, commonly known as barley. As its name suggests, this protein likely functions as a protective factor against cellular death processes in barley plants . The recombinant form of this protein is produced through genetic engineering techniques, enabling its availability for research purposes outside its native context.

Significance in Plant Biology

Cell death regulation is fundamental to plant development, defense responses, and stress adaptation. In barley, as in other plants, precisely controlled cell death processes are essential for normal growth and effective responses to pathogens. The existence of a specific "defender against cell death" protein suggests sophisticated regulatory mechanisms that balance cellular survival with appropriate cell death responses in this agriculturally important cereal crop.

Overview of Cell Death Processes in Barley

Barley employs complex mechanisms to regulate cell death in both developmental contexts and in response to stressors. Research has shown that proteins like the MLO (Mildew Locus O) modulator play crucial roles in this regulation. Wild-type MLO dampens cell wall-restricted hydrogen peroxide burst at points of attempted fungal penetration and suppresses oxidative burst and cell death in underlying mesophyll cells . This defensive mechanism highlights the critical role of controlled cell death in plant immunity.

Pathogen-Induced Cell Death Responses

In barley plants with mutant mlo alleles, researchers have documented both pathogen-induced cell death and spontaneous mesophyll cell death that appears to be part of accelerated leaf senescence . Specifically, a hydrogen peroxide (H₂O₂) burst occurs in mesophyll cells approximately 36 hours after pathogen inoculation, followed by irreversible membrane damage about 60 hours after inoculation, visible as trypan blue retention . These processes become macroscopically visible as localized necrosis 5 to 6 days after pathogen challenge.

Molecular Players in Barley Defense Responses

Several protein families have been identified as key regulators of defense responses in barley:

  1. MLO protein: Functions as a negative regulator of defense responses, with wild-type MLO playing a broad role in cell death protection, defense, and stress response processes .

  2. Germin-like proteins (GLPs): Encoded by multigene families, these proteins have demonstrated roles in defense against pathogen attack, with expression patterns that shift from developmental to conditional with increasing plant age .

  3. HvGER proteins: These proteins show complex interplay in the regulation of basal resistance against pathogens like Blumeria graminis f. sp. hordei, with some members (HvGER5) functioning as extracellular superoxide dismutases .

Within this complex network of defense regulators, DAD2 likely functions as an additional protective factor against inappropriate or excessive cell death.

Cell Death Regulation

Based on its nomenclature as a "defender against cell death," DAD2 likely functions to prevent inappropriate cell death in barley. It may act as a counterbalance to pro-death signals triggered by pathogens or environmental stressors, ensuring that cell death occurs only when beneficial to the plant's survival and health.

Possible Mechanisms of Action

Although specific mechanisms are not detailed in the available literature, DAD2 might function through:

  1. Regulation of reactive oxygen species (ROS): Given that hydrogen peroxide bursts precede cell death in barley defense responses , DAD2 may modulate ROS levels or activity.

  2. Signaling pathway modulation: DAD2 could interact with components of cell death signaling pathways, similar to how MLO influences defense and cell death signaling .

  3. Direct cellular protection: Like some GLP proteins that provide protection through enzymatic activities , DAD2 might directly protect cellular components from damage.

Relationship to Pathogen Defense

The regulation of cell death is crucial for effective pathogen defense in plants. Based on studies of other barley proteins, DAD2 might contribute to:

  1. Fine-tuning defense responses to prevent excessive tissue damage

  2. Protecting cells from oxidative damage during pathogen interactions

  3. Regulating the timing or extent of programmed cell death as part of the defense strategy

Barley as a Protein Production Platform

Understanding the production of recombinant proteins like DAD2 requires appreciation of barley's advantages as a production system. Barley seed serves as an excellent bioreactor for producing recombinant proteins due to its strong protein production machinery capable of generating high yields .

Advantages of Barley-Based Protein Production

Several key features make barley an ideal system for recombinant protein production:

Table 1: Advantages of Barley-Based Recombinant Protein Production

AdvantageDescription
Protein Production CapacityBarley seeds function as strong protein producers with machinery that can be utilized for high-yield recombinant protein synthesis
Protein StorageSeeds provide long-term, safe storage for proteins, making stockpiling and logistics both easy and economical
ScalabilityProduction can be rapidly scaled up through economical cultivation techniques without capital-intensive operations like bioreactors
Biological ContainmentSelf-pollinating flowers limit gene dispersal between plants, securing genetic containment in cultivation
SafetyGenerally recognized as safe for consumption, lacking potentially harmful ingredients such as secondary metabolites or mammalian pathogens

These advantages likely contributed to the selection of barley as the production system for recombinant DAD2.

Comparative Analysis of Cell Death Regulators in Barley

To better understand the potential role of DAD2, it's valuable to compare it with other known cell death regulators in barley.

Table 2: Comparison of Cell Death Regulators in Hordeum vulgare

ProteinPrimary FunctionRelationship to Cell DeathRelationship to Pathogen DefenseReference
MLODefense modulatorSuppresses oxidative burst and cell death in mesophyll cellsConfers susceptibility to Blumeria graminis f. sp. hordei
HvGER3GLP family memberUnknown direct relationshipSilencing protects barley epidermal cells from powdery mildew attack
HvGER4GLP family memberUnknown direct relationshipSilencing induces hypersusceptibility to powdery mildew
HvGER5Extracellular superoxide dismutaseRegulates ROS that can trigger cell deathOverexpression or silencing protects against powdery mildew
DAD2Likely defender against cell deathPresumably prevents inappropriate cell deathUnknown, but potentially involved in pathogen defense

This comparative analysis highlights the complex interplay of proteins involved in regulating cell death and defense responses in barley, with DAD2 likely providing an additional layer of protection against inappropriate cell death.

Potential Research Applications

While specific applications of DAD2 are not detailed in the available literature, likely research applications include:

  1. Investigation of cell death regulatory mechanisms in plants

  2. Studies of plant responses to pathogens, particularly fungal pathogens like Blumeria graminis

  3. Exploration of stress tolerance mechanisms in cereals and other crops

  4. Development of enhanced disease resistance strategies for agricultural applications

Knowledge Gaps and Future Research Directions

Despite the availability of recombinant DAD2, several significant knowledge gaps remain to be addressed by future research.

Table 3: Key Knowledge Gaps and Potential Research Directions

Knowledge GapPotential Research Direction
Molecular structure and functional domainsStructural analysis using X-ray crystallography or cryo-electron microscopy
Specific biochemical functionEnzymatic assays and functional characterization studies
Expression patterns in different tissues and conditionsTranscriptomic and proteomic analyses under various developmental stages and stress conditions
Interaction partnersProtein-protein interaction studies (e.g., yeast two-hybrid, co-immunoprecipitation)
Genetic regulationAnalysis of DAD2 gene promoter elements and transcriptional control mechanisms
Phylogenetic relationshipsComparative genomic analyses across plant species to identify homologs
Functional role in plantaOverexpression, knockdown, and knockout studies to assess phenotypic effects

Potential Experimental Approaches

To address these knowledge gaps, several experimental approaches could be employed:

  1. CRISPR/Cas9-mediated gene editing to create DAD2 knockout or modified barley lines

  2. Heterologous expression systems to produce and purify DAD2 for biochemical characterization

  3. Transcriptome and proteome profiling to identify DAD2-regulated genes and proteins

  4. In vitro and in vivo assays to assess DAD2's effects on cell death processes

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order for prioritized development.
Synonyms
DAD2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2; Oligosaccharyl transferase subunit DAD2; Defender against cell death 2; DAD-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
DAD2
Target Protein Sequence
MPKAAGDAKLLIQSLNKAYAATPTNLKIIDLYVVFAVATALVQVVYMGIVGSFPFNSFLS GVLSSIGTAVLGVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Uniprot No.

Target Background

Function
A subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation is a cotranslational process, and the OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.
Database Links

UniGene: Hv.2040

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Defender Against Cell Death (DAD) proteins in Hordeum vulgare?

DAD proteins in barley (Hordeum vulgare) function as critical cell death repressors, preventing programmed cell death (PCD) under various conditions. These proteins are part of a conserved family of PCD regulators alongside other inhibitors like Bax inhibitor 1 (BI-1), B-cell lymphoma2 (Bcl-2)-associated athanogene (BAG), and ER-luminal binding immunoglobulin protein (BiP) .

In barley specifically, DAD proteins are ER-localized and participate in ER stress signaling pathways. Their primary function appears to be protection against apoptotic death, which is crucial during both development and pathogen defense responses. Studies in related cereals have demonstrated that DAD proteins can significantly affect the expression of multiple defense-related genes .

How does DAD2 differ from DAD1 in cereals?

While the search results provide limited specific information distinguishing DAD2 from DAD1 in barley, evidence from wheat (Triticum aestivum) indicates functional differences. In wheat, TaDAD2-silenced leaves showed attenuated resistance to Puccinia striiformis and downregulated expression of several defense-related genes .

Both DAD1 and DAD2 appear to be involved in programmed cell death regulation, but potentially through different mechanisms or with varying tissue specificity. The conservation of these proteins across plant species suggests important evolutionary roles. In contrast to DAD1, which has been more extensively studied across species including Arabidopsis thaliana and rice, DAD2 research in barley represents a developing field with opportunities for further characterization .

What expression patterns does DAD2 exhibit in barley tissues?

Based on studies of DAD family proteins in cereals, expression patterns likely vary across tissue types and developmental stages. In barley, seven VPE (Vacuolar Processing Enzyme) homologs have been identified that interact with cell death pathways, with some specifically involved in PCD during the development of maternal seed tissues, including the nucellus and pericarp .

By comparison with other DAD proteins, DAD2 expression in barley may show temporal and spatial specificity, potentially increasing during pathogen challenge or stress conditions. The protein may be particularly active in tissues undergoing developmental transitions or responding to environmental stressors, similar to how HvVPE4 is exclusively expressed in deteriorating pericarp associated with apoptotic DNA degradation .

What are the optimal methods for recombinant expression of Hordeum vulgare DAD2?

For recombinant expression of barley DAD2, researchers have two primary approaches using the barley grain system itself:

  • Aleurone-specific expression system: This approach utilizes promoters of genes with aleurone-specific expression during germination, coupled with signal peptide code for protein export into the endosperm. This system is particularly useful for proteins that need post-translational modifications specific to the aleurone layer .

  • Storage protein promoter system: This method employs promoters of the structural genes for storage proteins that are deposited in the developing endosperm. The D hordein gene promoter has been successfully used for recombinant protein production in barley grains .

For both systems, transformation protocols typically involve Agrobacterium-mediated methods or particle bombardment. Expression constructs should include appropriate barley-specific regulatory elements to ensure proper tissue localization and developmental timing of expression.

How can researchers verify the subcellular localization of recombinant DAD2 in barley cells?

Verification of subcellular localization for recombinant DAD2 in barley cells requires multiple complementary approaches:

  • Immunolocalization with specific antibodies: Using polyclonal antibodies developed against DAD2 protein, similar to those available for other barley proteins. Commercial antibodies like those from Agrisera (e.g., AS23 4941, AS23 4942) reactive with Hordeum vulgare could be adapted for this purpose .

  • Fluorescent protein fusions: Creating GFP or other fluorescent protein fusions with DAD2 for transient expression and visualization in barley cells.

  • Subcellular fractionation: Isolating different cellular compartments followed by Western blot analysis using extraction buffers optimized for membrane proteins (similar to AS08 300) .

  • Co-localization studies: Using established ER markers alongside DAD2 detection to confirm the expected ER localization, similar to approaches used with other DAD family proteins.

Proper controls should include known compartment markers for the endoplasmic reticulum, as DAD proteins are expected to localize primarily to the ER membrane .

What phenotypic assays are most reliable for evaluating DAD2 function in transgenic barley?

The most reliable phenotypic assays for evaluating DAD2 function in transgenic barley include:

  • Pathogen challenge assays: Inoculating plants with pathogens like powdery mildew fungi (Blumeria graminis f.sp. hordei) and measuring penetration efficiency and disease progression. This approach has been successful with related proteins like BI-1, where overexpression led to measurable changes in pathogen susceptibility .

  • Cell death quantification: Tracking programmed cell death using vital stains like trypan blue or Evans blue, or through measurement of electrolyte leakage.

  • Stress tolerance assessment: Exposing plants to abiotic stressors (drought, salt, heat) and quantifying survival rates, growth parameters, and tissue damage.

  • Histochemical detection of ROS: Using diaminobenzidine (DAB) or nitroblue tetrazolium (NBT) staining to visualize reactive oxygen species accumulation as an indicator of cell death pathway activation.

  • Gene expression analysis: Measuring changes in defense-related genes using qRT-PCR, as DAD proteins have been shown to affect the expression of multiple defense-related genes .

How does DAD2 integrate with broader cell death regulatory networks in barley?

DAD2 likely functions within a complex regulatory network controlling programmed cell death in barley. This network includes:

  • Interaction with ER stress signaling: As an ER-localized protein, DAD2 likely participates in the unfolded protein response (UPR) pathway, similar to DAD1 in other systems. This involves sensing ER stress and transmitting signals to prevent or initiate cell death .

  • Crosstalk with BAX inhibitor pathways: Research on barley BAX inhibitor 1 (BI-1) shows that overexpression affects susceptibility to powdery mildew fungus, suggesting coordination between multiple cell death regulatory proteins . The relationship between BI-1 and DAD2 may involve:

    ProteinPrimary LocationFunction in Cell DeathEffect on Pathogen Response
    DAD2ER membranePCD inhibitionPotential enhanced resistance
    BI-1ER membranePCD inhibitionEnhanced accessibility to Bgh
    MLOPlasma membraneDefense regulationSusceptibility factor
  • Integration with MLO-mediated resistance: In barley, the MLO protein functions as a negative regulator of defense and cell death. Studies have shown that BI-1 overexpression can reconstitute susceptibility to fungal penetration in mlo5 genotypes . DAD2 may have similar interactions with this resistance pathway.

  • Vacuolar processing enzyme (VPE) connections: In barley, VPEs are involved in PCD during seed development. The potential interaction between DAD2 and these enzymes represents an important area for investigation .

What are the challenges in generating stable DAD2 knockout or overexpression lines in barley?

Researchers face several significant challenges when attempting to generate stable DAD2 knockout or overexpression lines in barley:

  • Transformation efficiency: Barley transformation remains technically challenging with lower efficiency compared to model plants. Researchers must optimize protocols for specific barley cultivars, as transformation efficiency varies significantly between genotypes .

  • Potential lethality: If DAD2 is essential for normal development, complete knockout may be lethal or cause severe developmental abnormalities, making it difficult to recover homozygous knockout lines.

  • Functional redundancy: Other cell death inhibitors like DAD1 or BI-1 may compensate for DAD2 loss, masking phenotypes in single gene knockouts and necessitating multiple gene targeting approaches .

  • Tissue culture challenges: Regeneration of barley plants following transformation can be problematic, with issues including somaclonal variation and recalcitrance of certain genotypes to tissue culture protocols.

  • Transgene silencing: Overexpression constructs may trigger gene silencing, especially when using strong constitutive promoters, requiring careful design of expression cassettes and selection of appropriate promoters .

  • Phenotypic evaluation complexity: The phenotypic outcomes of DAD2 modification may be subtle or condition-dependent, requiring sophisticated phenotyping approaches across multiple growth stages and environmental conditions .

How might post-translational modifications affect DAD2 function in barley?

Post-translational modifications (PTMs) likely play crucial roles in regulating DAD2 function in barley:

  • Phosphorylation sites: As a membrane protein involved in stress signaling, DAD2 likely contains phosphorylation sites that regulate its activity or interactions with other proteins. These modifications may occur in response to pathogen recognition or abiotic stress signals.

  • Glycosylation: If DAD2 contains extracellular or luminal domains, N-linked or O-linked glycosylation may affect protein folding, stability, or interaction capabilities.

  • Ubiquitination: Regulation of DAD2 protein levels during stress responses may involve the ubiquitin-proteasome system, affecting the protein's half-life and abundance.

  • Disulfide bond formation: The redox environment of the ER affects disulfide bond formation, which may be critical for DAD2 structure and function, particularly during oxidative stress conditions.

  • Proteolytic processing: Similar to other cell death regulators, DAD2 might undergo specific proteolytic processing events that alter its function, possibly converting it between active and inactive forms.

Experimental approaches to study these modifications would include mass spectrometry-based proteomics, site-directed mutagenesis of potential modification sites, and in vitro biochemical assays with purified components.

How does DAD2 expression correlate with pathogen resistance in barley varieties?

The correlation between DAD2 expression and pathogen resistance in barley likely follows patterns similar to other cell death regulators in cereals:

  • Differential expression patterns: Studies in related systems suggest DAD2 expression may vary between susceptible and resistant barley varieties when challenged with pathogens. For example, research on BI-1 in barley showed differential expression in response to Blumeria graminis f.sp. hordei (Bgh) in susceptible versus resistant plants .

  • Chemical induction effects: Treatment with resistance-inducing compounds like 2,6-dichloroisonicotinic acid may alter DAD2 expression levels, similar to how such treatments down-regulated BI-1 expression in barley .

  • Tissue-specific responses: DAD2 expression patterns likely differ across tissue types during infection, potentially showing higher expression in barrier tissues directly interacting with pathogens.

  • Temporal dynamics: Expression levels may change dynamically throughout the infection process, with early expression potentially differing from later stages as defense responses evolve.

Analysis of historical phenotypic data from barley germplasm collections, similar to the approach described for other traits , could reveal correlations between DAD2 sequence variants or expression levels and disease resistance phenotypes across diverse barley accessions.

How can DAD2 be targeted for improving stress tolerance in barley?

DAD2 presents several promising approaches for improving stress tolerance in barley:

  • Controlled overexpression strategies: Using tissue-specific or stress-inducible promoters to drive DAD2 expression could enhance tolerance to specific stressors while avoiding potential negative developmental effects of constitutive overexpression.

  • Promoter engineering: Modifying the native DAD2 promoter using CRISPR/Cas9 could alter its expression patterns to optimize stress responses without introducing foreign DNA.

  • Allele mining: Screening diverse barley germplasm for natural DAD2 variants associated with enhanced stress tolerance could identify superior alleles for breeding programs.

  • Co-expression with complementary genes: Combining DAD2 modification with other genes in the cell death regulatory network might produce synergistic effects on stress tolerance.

  • Structure-guided protein engineering: Creating modified versions of DAD2 with enhanced stability or activity based on protein structural information could improve its function under stress conditions.

For field implementation, researchers should consider:

ApproachAdvantagesChallengesTimeline
Transgenic overexpressionPrecise control, strong effectsRegulatory hurdles, public acceptance5-7 years
CRISPR-based promotion modificationNon-transgenic, targetedOff-target effects, regeneration issues3-5 years
Marker-assisted selectionReadily acceptable, uses natural variationLimited by existing diversity3-4 years
Protein engineeringPotential novel functionsComplex validation, delivery challenges7-10 years

What is the relationship between DAD2 and ROS signaling during pathogen response in barley?

The relationship between DAD2 and reactive oxygen species (ROS) signaling during pathogen response in barley likely involves several interconnected mechanisms:

  • ER stress and ROS production: As an ER-localized protein, DAD2 may regulate ROS production from the ER during stress conditions. The ER is a significant source of ROS during pathogen challenge, and DAD2 may help maintain ER homeostasis.

  • Modulation of the oxidative burst: DAD2 could influence the timing or magnitude of the pathogen-induced oxidative burst, a rapid production of ROS that serves as an early defense response and signaling mechanism.

  • Antioxidant enzyme regulation: DAD2 may affect the expression or activity of antioxidant enzymes (superoxide dismutase, catalase, peroxidases) that detoxify ROS, helping to prevent excessive cellular damage.

  • Redox-dependent signaling: The function of DAD2 itself might be regulated by the cellular redox state, creating a feedback loop between DAD2 activity and ROS levels.

  • Cell death threshold determination: By modulating ROS homeostasis, DAD2 could help establish thresholds for cell death initiation during pathogen attack, determining whether cells survive and contain the infection or undergo programmed cell death to prevent pathogen spread.

Similar to studies on BI-1 in barley , experimental approaches to investigate these relationships could include analyzing ROS accumulation in DAD2-overexpressing or silenced plants, measuring oxidative stress markers, and examining the expression of ROS-responsive genes in modified lines.

What emerging technologies could advance our understanding of DAD2 function in barley?

Several cutting-edge technologies hold promise for advancing our understanding of DAD2 function in barley:

  • Single-cell transcriptomics: This approach could reveal cell-type specific expression patterns of DAD2 and co-regulated genes, providing insights into its role in particular tissues or developmental contexts.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 fused to DAD2 could identify proteins that physically interact with DAD2 in living barley cells, helping to map its protein interaction network.

  • Cryo-electron microscopy: Structural determination of DAD2 and its complexes would provide molecular insights into its function and potential for rational engineering.

  • Optogenetic tools: Developing light-controlled variants of DAD2 would allow precise temporal and spatial control of its activity in planta, enabling detailed analysis of its function.

  • CRISPR base editing and prime editing: These precise genome editing approaches could introduce specific mutations in DAD2 without double-strand breaks, facilitating structure-function studies.

  • Long-read sequencing: This technology could uncover complex structural variants and regulatory elements affecting DAD2 expression across diverse barley germplasm.

  • Advanced phenomics platforms: High-throughput, non-destructive phenotyping could capture subtle or transient phenotypes in DAD2-modified plants under various stresses.

What are the challenges in translating DAD2 research from model systems to crop improvement?

Translating DAD2 research from model systems to barley crop improvement faces several significant challenges:

  • Functional divergence: DAD2 function in barley may differ from that in model plants like Arabidopsis, requiring barley-specific characterization rather than relying on knowledge transfer from models.

  • Genetic background effects: The impact of DAD2 modification likely varies across different barley cultivars due to interactions with other genetic factors, complicating broad implementation.

  • Environmental stability: Beneficial effects of DAD2 modifications observed under controlled conditions may not translate to diverse field environments where multiple stresses occur simultaneously.

  • Pleiotropic effects: Altering cell death pathways through DAD2 modification may have unintended consequences on development, yield, or quality traits that are difficult to predict from model systems.

  • Regulatory hurdles: Deployment of genetically modified barley varieties faces significant regulatory challenges and public acceptance issues in many regions.

  • Scale-up limitations: Technologies that work in laboratory settings (like transient expression) require substantial adaptation for application at field scale.

  • Economic considerations: The cost-benefit ratio of implementing DAD2-based improvements must be favorable compared to conventional breeding approaches.

Researchers can address these challenges through:

  • Conducting field trials under diverse conditions

  • Developing non-transgenic approaches using gene editing

  • Creating strong industry-academic partnerships

  • Exploring native genetic diversity for beneficial DAD2 alleles

How might DAD2 function be affected by changing climate conditions in barley cultivation?

Climate change presents multiple stressors that may significantly impact DAD2 function in barley:

  • Heat stress interactions: Elevated temperatures are likely to affect DAD2's role in cell death regulation, as heat stress can trigger ER stress and protein misfolding. DAD2's function in maintaining ER homeostasis may become more critical under increasing temperature extremes.

  • Drought response modulation: Water limitation triggers complex stress responses in barley, and DAD2 may play an important role in determining whether cells survive or undergo programmed cell death during drought conditions.

  • Altered pathogen pressure: Climate change is expected to modify pathogen distribution and virulence. DAD2's role in pathogen defense responses may face new challenges as disease pressure evolves.

  • CO₂ concentration effects: Elevated atmospheric CO₂ alters plant metabolism and potentially stress signaling pathways. This could indirectly affect DAD2 function through changes in cellular redox status or energy availability.

  • Unpredictable stress combinations: The simultaneous occurrence of multiple stresses (heat, drought, pathogens) may create novel cellular environments that affect DAD2 function in ways not predictable from single-stress studies.

Research approaches to address these questions include:

  • Growth chamber experiments simulating future climate scenarios

  • FACE (Free-Air CO₂ Enrichment) studies examining DAD2 expression and function

  • Analysis of DAD2 sequence and expression variation in barley grown across diverse climatic regions

  • Development of climate-resilient barley varieties with optimized DAD2 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.