Name: Recombinant Hordeum vulgare High molecular mass early light-inducible protein HV58, chloroplastic, Short name= ELIP
Sequence: VRAQTEVSLHVARTITVSVFGCLPASTITSRLDLTVNLFVYVQPDMDSAKETTSASTSPSPSQYTSPSPTTIPAAPKPVTKKANPSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAE LWNGRFAMLGLVALAATEFITGAPFVNI
ELIP mRNA and protein levels are related to sunlight intensity . The expression of ELIPs is independent of the developmental stage of the leaves . ELIP mRNA and protein still accumulate to high levels on bright days, even after the onset of senescence, when chlorophyll content and photosystem II (PSII) efficiency decrease .
ELIPs are induced by light and accumulate under high-light stress, which correlates with photoinhibition of photosystems, degradation of the D1 protein, and changes in pigment levels . These proteins can protect PSII functionality under high-light conditions .
Light-induced expression: Light induces the accumulation of LHC Ib mRNAs, which are regulated by phytochrome. LHC Ib polypeptide accumulation in the thylakoid membrane lags behind transcript accumulation .
Photoprotection: Overexpression of ScELIPs can protect PSII functionality of Arabidopsis plantlets under high-light conditions .
Chloroplast development: Proteins are involved in chloroplast development in barley .
Heat-shock protein complex: A high-molecular mass heat-shock protein complex exists in barley chloroplasts, with a size of 250 to 265 kD . Denaturing polyacrylamide gel electrophoresis revealed that this complex has a single protein component, a 32-kD heat-shock protein .
HV58 is a high molecular mass early light-inducible protein found in Hordeum vulgare (barley). It is localized in the chloroplast and belongs to a family of stress-responsive proteins that are typically induced under various environmental conditions. The mature protein spans amino acids 32-231, as indicated by the recombinant protein specifications . The chloroplastic localization suggests its involvement in photosynthetic processes or stress protection mechanisms within this organelle, which is consistent with barley's use as a model organism for studying chloroplast development and photosynthesis .
The transcriptome profiling data indicates that HV58 genes are significantly upregulated under stress conditions, particularly drought (D) and combined heat and drought (HD) stress . Expression analysis shows enhanced expression "mostly in groups S and M under D and HD, especially in T2," with four genes identified as encoding the high molecular mass early light-inducible protein HV58 . This expression pattern suggests that HV58 plays an important role in the plant's response to environmental stressors, particularly water deprivation, which aligns with its classification as a stress-responsive protein.
HV58 belongs to the family of early light-inducible proteins (ELIPs) that are typically induced during early stages of light exposure or stress conditions. While specific comparative data on HV58 and other ELIPs is limited in the provided search results, research on plant stress responses indicates that these proteins often share functional similarities but may have species-specific or stress-specific roles. The presence of multiple genes encoding HV58 (as mentioned in search result ) suggests potential functional diversification within this protein family in barley. ELIPs are generally thought to protect the photosynthetic apparatus during stress conditions, which would be consistent with HV58's enhanced expression during drought stress.
For studying HV58 expression patterns, researchers should consider:
Transcriptome profiling: RNA-Seq analysis has been successfully used to detect differential expression of HV58 genes under various stress conditions . This approach provides comprehensive gene expression data across the entire genome.
qRT-PCR validation: Following transcriptome analysis, quantitative real-time PCR can be used to validate the expression patterns of specific HV58 genes under controlled stress conditions.
Protein immunodetection: Antibodies specific to Hordeum vulgare are available (e.g., AS08 317 polyclonal antibody) and can be used for western blot analysis to detect protein levels.
Time-course experiments: As indicated by the differential expression at different time points (T1 and T2) in the transcriptome studies , including multiple time points in experimental designs is crucial for capturing the dynamic regulation of HV58.
Based on established protocols for recombinant chloroplastic proteins:
Expression system selection: E. coli has been successfully used as an expression host for recombinant HV58 with His-tag , which facilitates purification.
Protein extraction: For optimal protein extraction from plant tissues, specialized buffers like AS08 300 have been developed for "quantitative isolation of total soluble/membrane protein from plant tissue" .
Affinity chromatography: His-tagged recombinant HV58 can be purified using nickel affinity chromatography, a standard method for His-tagged proteins.
Protein folding consideration: As a chloroplastic protein, proper folding may require specific conditions. Researchers should consider including molecular chaperones in the expression system or optimizing folding conditions post-purification.
Verification: Western blotting with antibodies against HV58 or the His-tag can confirm successful purification.
Transcriptome data indicates that HV58 plays a significant role in plant responses to drought and combined heat-drought stress conditions . The functional analysis suggests:
Stress-specific upregulation: HV58 genes show enhanced expression primarily in drought and combined heat-drought conditions, suggesting a specialized role in water deficit responses .
Temporal dynamics: The expression patterns vary at different time points (T1 vs. T2) after stress application, indicating a dynamic regulatory process .
Correlation with other stress-responsive genes: HV58 upregulation correlates with the expression of other stress-related genes, including those involved in ABA signaling and heat shock responses, suggesting its integration in broader stress response networks .
Size-dependent responses: The differential expression across different flag leaf size groups (S, M, L) suggests that HV58 function may be influenced by developmental or morphological factors .
The coordinated upregulation with dehydrins and heat shock factors indicates that HV58 may function as part of a protective mechanism for photosynthetic machinery during environmental stress.
Based on the transcriptome profiling data:
Stress-responsive elements: HV58 expression appears to be regulated by stress-responsive transcription factors, particularly those involved in drought and heat responses .
ABA-mediated regulation: The co-expression of HV58 with genes involved in ABA biosynthesis and signaling (such as 9-cis-epoxycarotenoid dioxygenases) suggests that its expression may be influenced by the ABA signaling pathway, a key regulator of drought responses .
Heat shock factor network: The concurrent upregulation of heat shock factors (HSFs) with HV58 under stress conditions indicates that HSF transcription factors may be involved in regulating HV58 expression .
Temporal regulation: The differential expression at different time points (T1 vs. T2) suggests complex temporal regulation mechanisms that may involve both immediate and adaptive responses to stress .
Recombinant HV58 offers several potential applications in chloroplast engineering and crop improvement:
Stress tolerance enhancement: Given HV58's upregulation during drought stress, introducing additional copies or modified versions of this protein could potentially enhance stress tolerance in crops .
Chloroplast transformation: The chloroplast genome has been successfully engineered to confer various agronomic traits, including "herbicide resistance, insect resistance, disease resistance, drought tolerance, salt tolerance, and phytoremediation" . HV58, as a chloroplast-localized stress-responsive protein, could be a valuable target for such engineering approaches.
Marker protein: Recombinant HV58 with tags (such as His-tag ) can serve as a marker protein for studying chloroplast protein import and localization mechanisms.
Functional studies: Recombinant HV58 can be used in in vitro studies to investigate its interactions with other chloroplast proteins and its potential protective functions during stress conditions.
Molecular farming: The chloroplast genetic engineering platform has been utilized for "expression of biomaterials, human therapeutic proteins, and vaccines" , suggesting potential biotechnological applications for recombinant chloroplastic proteins like HV58.
To investigate HV58's potential role in retrograde signaling (chloroplast-to-nucleus communication):
Mutant analysis: Utilizing barley mutants with altered HV58 expression or function, such as those with modified chloroplast development like albostrians, which have helped discover "retrograde (chloroplast-to-nucleus) signalling communication pathway" .
Reporter gene assays: Developing nuclear-encoded reporter constructs responsive to chloroplast signals to monitor changes in gene expression in response to HV58 manipulation.
Protein interaction studies: Using recombinant HV58 protein to identify interaction partners that might function in signaling pathways between the chloroplast and nucleus.
Transcriptome analysis: Comparing nuclear gene expression profiles in plants with normal versus altered HV58 expression to identify potential signaling targets.
Chloroplast isolation and manipulation: Isolating intact chloroplasts using techniques like those described for chloroplast genome amplification (e.g., "Purified chloroplast pellets were resuspended in a final volume of 2 ml" ) to study signaling molecules produced under different conditions.
Understanding HV58's interaction with photosynthetic components requires:
Co-immunoprecipitation studies: Using antibodies against HV58 (such as those available from Agrisera ) to pull down interacting proteins from the photosynthetic apparatus.
Proteomics analysis: Comparative proteomics of chloroplast fractions from stressed and non-stressed plants to identify changes in protein associations involving HV58.
Electron microscopy: Immunogold labeling with HV58 antibodies to localize the protein within chloroplast substructures in relation to photosynthetic complexes.
Functional assays: Measuring photosynthetic parameters (e.g., quantum yield, electron transport rate) in plants with altered HV58 expression to assess functional impacts.
Spectroscopic analysis: Using recombinant HV58 to study its interaction with chlorophyll and other photosynthetic pigments through absorption and fluorescence spectroscopy.
The transcriptome data suggests several interactions within stress response networks:
Co-expression with dehydrins: Eight dehydrin genes were found to be co-regulated with HV58 under drought stress conditions, suggesting functional relationships in stress response mechanisms .
Heat shock protein network: HV58 upregulation correlates with increased expression of heat shock proteins and factors (including HSP20, heat shock factor C1b, and heat shock factor C2b), indicating potential functional relationships in heat stress responses .
Annexin association: Differential expression of annexin genes (D4-like and D1) parallels HV58 expression patterns, suggesting possible coordinated functions in stress response .
ABA signaling components: The concurrent regulation of genes involved in ABA biosynthesis and signaling with HV58 indicates integration into hormone-mediated stress response pathways .
Researchers should consider:
Genetic background variation: Different barley varieties may have variations in HV58 gene sequence or regulation that could affect experimental outcomes. The differences between cultivars should be characterized before comparative studies.
Developmental stage selection: Expression patterns of HV58 vary with development, as indicated by the differential responses in different flag leaf size groups (S, M, L) , so standardizing developmental stages is crucial.
Environmental controls: Given HV58's responsiveness to environmental stressors, strict control of growth conditions is essential for reproducible results.
Tissue specificity: Careful selection and consistent sampling of specific tissues is important, as protein expression may vary between different plant parts.
Time point selection: The differential expression at different time points after stress application (T1 vs. T2) highlights the importance of temporal sampling in capturing the dynamic regulation of HV58.
To study post-translational modifications (PTMs) of HV58:
Mass spectrometry: LC-MS/MS analysis of purified HV58 protein can identify various PTMs such as phosphorylation, acetylation, or glycosylation.
2D gel electrophoresis: This can separate protein isoforms with different PTMs based on both molecular weight and isoelectric point.
Phospho-specific antibodies: For detecting phosphorylated forms of HV58 if phosphorylation is a suspected regulatory mechanism.
In vitro modification assays: Using recombinant HV58 as a substrate for various modification enzymes to determine potential PTM sites.
Site-directed mutagenesis: Modifying potential PTM sites in recombinant HV58 to assess their functional significance in stress response mechanisms.