Recombinant Hordeum vulgare MLO protein homolog 1 (MLO-H1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Biology

Pathogen Defense Modulation

  • Wild-type MLO-H1 suppresses:

    • Hydrogen peroxide bursts at fungal penetration sites

    • Mesophyll cell death post-infection

  • mlo mutants show:

    • Enhanced resistance to B. graminis

    • Spontaneous cell death mimicking accelerated senescence

Mechanistic Insights

  • Acts as negative regulator of:

    • Reactive oxygen species (ROS) accumulation

    • Callose deposition at infection sites

  • Interacts with calcium sensor proteins to modulate defense signaling

Research Applications

Experimental Uses

  1. Powdery Mildew Resistance Studies
    Used to characterize allele-specific interactions (e.g., mlo-12, mlo-16) impacting fungal penetration efficiency .

  2. Protein Interaction Mapping
    Serves as bait in yeast two-hybrid screens to identify calcium-dependent signaling partners .

  3. Structure-Function Analysis
    Missense mutations (e.g., D146G, S198F) linked to partial resistance phenotypes :

    MutationPhenotypeROS Suppression Efficiency
    Wild-typeSusceptible100%
    mlo-5Full resistance23% ± 4%
    mlo-12Partial resistance58% ± 7%

Key Research Findings

Pathogen Response Dynamics

  • Dual oxidative bursts:

    1. Primary: Cell wall-localized H₂O₂ within 24h post-inoculation

    2. Secondary: Mesophyll burst at 48h, suppressed by MLO-H1

Evolutionary Conservation

  • Orthologs identified in Rosa chinensis (RhMLO1/2) and Fragaria vesca (FvMLO11) share 72-84% sequence similarity .

Agricultural Impact

  • Non-functional MLO variants form the basis of durable mildew resistance in modern barley cultivars .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the most accurate delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO-H1; MLO protein homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
MLO-H1
Target Protein Sequence
MAGPAGGRELSDTPTWAVAVVCAVMILVSVAMEHALHKLGHWFHKWRKKALGEALEKMKA ELMLVGFISLLLIVTQDPVSRICISKEAGEKMLPCKPYDGAGGGKGKDNHRRLLWLQGES ETHRRFLAAPAGVDVCAKQGKVALMSAGSMHQLHIFIFVLAVFHVLYSVVTMTLSRLKMK QWKKWESETASLEYQFANDPSRCRFTHQTTLVRRHLGLSSTPGVRWVVAFFRQFFTSVTK VDYLTLRQGFINAHLSQGNRFDFHKYIKRSLEDDFKVVVRISLKLWFVAVLILFLDFDGI GTLLWMSVVPLVILLWVGTKLEMVIMEMAQEIHDRESVVKGAPAVEPSNKYFWFNRPDWV LFLMHLTLFQNAFQMAHFVWTVATPGLKKCYHEKMAMSIAKVVLGVAAQILCSYITFPLY ALVTQMGSHMKRSIFDEQTAKALTNWRKMAKEKKKARDAAMLMAQMGGGATPSVGSSPVH LLHKAGARSDDPQSVPASPRAEKEGGGVQHPARKVPPCDGWRSASSPALDAHIPGADFGF STQR
Uniprot No.

Target Background

Function
This protein may be involved in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO-H1 and what is its functional significance?

MLO-H1 (Mildew Resistance Locus O Protein Homolog 1) is a membrane protein encoded by the barley genome that plays a significant role in susceptibility to powdery mildew disease. The protein is 544 amino acids in length and is typically expressed as a recombinant protein with a histidine tag when used in research applications . The significance of MLO-H1 lies primarily in its role in plant-pathogen interactions, particularly with the powdery mildew fungus Blumeria graminis. Natural or induced loss-of-function mutations in MLO genes (resulting in mlo alleles) confer durable broad-spectrum resistance against powdery mildew pathogens, making it a valuable target for crop improvement research .

In barley plants with mlo mutations, pathogen growth is nearly completely arrested at the penetration stage, preventing the development of haustoria (specialized feeding structures) by the fungal pathogen . This resistance mechanism has been extensively studied in barley and has significant implications for developing disease-resistant varieties in other important cereal crops including wheat, which contains orthologous MLO genes.

How does MLO-H1 structure relate to its function in powdery mildew susceptibility?

The functional domains of MLO-H1 include several cytoplasmic loops that are critical for its activity as a susceptibility factor. Research has specifically identified the second and third cytoplasmic loops of the barley Mlo protein as regions highly relevant for its powdery mildew susceptibility-conferring activity . Mutations in these specific regions of the Mlo protein that lead to single amino acid exchanges (missense mutations) often result in loss-of-function of the protein, conferring resistance against powdery mildew pathogens .

The third cytoplasmic loop, encoded by exon 9 of the MLO gene, has been a particular focus for research targeting resistance mechanisms. This region appears to be critical for the protein's interaction with powdery mildew pathogens, making it an ideal target for mutagenesis approaches such as TILLING (Targeting Induced Local Lesions IN Genomes) screening . The high conservation of MLO proteins between barley and wheat (approximately 89% sequence identity) has allowed for cross-species experimental approaches, further supporting the structural significance of these cytoplasmic loops in pathogen susceptibility.

What are the key orthologues of MLO-H1 in other cereal crops?

In hexaploid bread wheat (Triticum aestivum), three orthologues of barley Mlo have been identified: TaMlo-A1, TaMlo-B1, and TaMlo-D1 . These orthologues are located on chromosomes 5AL, 4BL, and 4DL, respectively . The high level of sequence identity between wheat and barley Mlo proteins (approximately 89%) enables cross-species functional studies and complementation assays .

Unlike barley, natural wheat mlo mutants have not been reported, likely due to the hexaploid nature of bread wheat, which would require mutation of all six gene copies (three homoeologous genes, each with two alleles) to generate a detectable resistance phenotype . This genetic complexity makes wheat MLO research more challenging but also presents unique opportunities for investigating gene dosage effects and functional redundancy among homoeologues.

Other cereal crops also contain MLO orthologues with varying degrees of similarity to barley MLO-H1, making this a conserved susceptibility factor across many economically important grass species.

What experimental approaches are most effective for studying MLO-H1 function?

Several sophisticated experimental approaches have proven effective for studying MLO-H1 function:

Transient Gene Expression Assays: Particle bombardment-based barley transient expression assays provide a rapid system for evaluating MLO protein variants. This approach leverages the ability of wheat TaMlo genes to complement powdery mildew-resistant barley mlo mutants at the single-cell level in leaf epidermal tissue . The technique involves bombarding epidermal cells with expression constructs (typically MLO cDNAs driven by the maize Ubiquitin1 promoter), followed by inoculation with powdery mildew spores and assessment of host cell entry rates .

Site-Directed Mutagenesis: PCR-based site-directed mutagenesis enables the recreation of specific missense mutations in MLO cDNA to study their functional effects. This approach has been used to generate variants corresponding to mutations identified through TILLING screens, allowing researchers to evaluate how specific amino acid substitutions affect powdery mildew susceptibility .

In Planta Resistance Assays: Direct assessment of powdery mildew resistance in plants carrying MLO mutations provides the most relevant biological readout. These assays typically involve inoculating plants with powdery mildew spores and quantifying the rate of host cell entry and fungal development .

Importantly, there can be discrepancies between results obtained from transient overexpression assays and observations in stable mutant plants. For example, in the case of barley mlo-38, the host cell entry rate in stable mutant plants (less than 6%) was substantially lower than the rate observed in transient expression assays (approximately 20%), suggesting that overexpression may partially compensate for functional defects in the protein .

How can TILLING technology be applied to identify novel MLO mutations?

TILLING (Targeting Induced Local Lesions IN Genomes) is a non-transgenic approach that has proven valuable for identifying novel MLO mutations with potential applications in breeding powdery mildew-resistant varieties. The methodology involves:

Target Selection: Based on functional studies of barley Mlo, the third cytoplasmic loop (encoded by exon 9) was identified as a critical region for powdery mildew susceptibility, making it an ideal target for TILLING screening .

Primer Design: The development of homoeologue-specific primers is crucial for TILLING in polyploid species like wheat. This typically involves a two-step PCR approach:

  • First-round PCR with homoeologue-specific primers to amplify products containing the target exon (750-1700 bp depending on the TaMlo homoeologue)

  • Second-round PCR with additional homoeologue-specific primers producing amplicons of approximately 310 bp for High-Resolution Melt (HRM) analysis

Mutation Detection: High-Resolution Melt (HRM) analysis is employed to detect sequence variations in PCR amplicons. This technique is most accurate for DNA fragments up to about 300 bp in size .

Validation: Identified mutations are confirmed by direct amplicon sequencing and further validated through functional assays such as transient expression in barley epidermal cells .

Through TILLING approaches, researchers have identified multiple missense mutations in wheat TaMlo homoeologues, including equivalents of previously characterized barley mlo mutants such as mlo-29 (P335L) and mlo-38 (G319R) . These mutations can then be stacked through conventional breeding to generate lines with potentially enhanced resistance to powdery mildew.

What is the significance of missense mutations in MLO proteins for powdery mildew resistance?

Missense mutations in MLO proteins that lead to single amino acid substitutions can significantly impact powdery mildew susceptibility, with certain mutations conferring strong resistance:

Position-Specific Effects: The impact of missense mutations depends heavily on their location within the protein. Mutations in the second and third cytoplasmic loops often result in significant reductions in protein function . For example, in barley, mutations like mlo-29 (P334L) and mlo-38 (G318R) reduce host cell entry rates to less than 6% compared to approximately 85% in wild-type plants .

Stacking of Mutations: By combining multiple mutant alleles across homoeologues, researchers have generated wheat lines with enhanced resistance to powdery mildew. Notably, both homozygous triple mutant lines and some homozygous double mutant lines showed improved resistance without discernible pleiotropic phenotypes that typically accompany mlo-mediated resistance in barley .

The table below summarizes key barley mlo mutations and their effects on powdery mildew susceptibility:

MutationAmino Acid ChangeHost Cell Entry Rate (%)Resistance Level
Wild-typeN/A~85%Susceptible
mlo-38 (SR59)G318R<6%Highly Resistant
mlo-38 (SR65)G318R<6%Highly Resistant
mlo-29P334L<6%Highly Resistant

These findings illustrate the potential of targeted MLO mutations for developing powdery mildew-resistant wheat varieties without relying on transgenic approaches .

How do pleiotropic effects associated with MLO mutations impact their utility in crop improvement?

While MLO mutations confer valuable disease resistance, they are often accompanied by pleiotropic effects that must be carefully considered in crop improvement programs:

Spontaneous Defense Responses: In barley mlo lines, resistance is typically associated with several pleiotropic phenotypes, including spontaneous deposition of callose-containing cell wall appositions, which represent constitutively activated defense responses even in the absence of pathogens .

Premature Senescence: Other pleiotropic effects include early chlorophyll decay and spontaneous mesophyll cell death, leading to chlorotic and necrotic leaf flecking. These symptoms have been interpreted as signs of premature leaf senescence .

Yield Implications: The physiological costs associated with constitutive defense responses and premature senescence may impact plant growth and yield, potentially offsetting the benefits gained from disease resistance.

Strategies to Mitigate Pleiotropy: Several approaches may reduce pleiotropic effects:

  • Partial Loss-of-Function Alleles: Identifying missense mutations that retain some MLO function while reducing susceptibility

  • Homoeologue-Specific Targeting: In polyploid species like wheat, mutating specific homoeologues while leaving others functional

  • Tissue-Specific Modification: Limiting MLO modifications to epidermis where powdery mildew infection occurs

Encouragingly, wheat lines with mutations in multiple TaMlo homoeologues have shown enhanced powdery mildew resistance without discernible pleiotropic phenotypes, suggesting that careful selection and combination of mutant alleles may overcome the negative aspects of mlo-mediated resistance .

What techniques can be used to validate MLO-H1 mutant candidates?

Multiple complementary techniques can be employed to validate MLO-H1 mutant candidates:

Transient Gene Expression Assays: This approach leverages the ability of wheat TaMlo genes to complement barley mlo mutants at the single-cell level. By bombarding barley mlo mutant leaves with constructs expressing wheat MLO variants, researchers can assess whether the mutations affect protein function . The percentage of successful fungal penetration (host cell entry) serves as a quantitative measure of MLO functionality .

In Planta Resistance Assessment: Direct evaluation of powdery mildew infection in plants carrying the mutations provides the most relevant biological validation. For barley mutants like mlo-29 and mlo-38, in planta resistance levels (host cell entry rates <6%) were even stronger than predicted by transient expression assays (approximately 20% for mlo-38) . This suggests that transient overexpression may partially mask functional defects, making in planta assessment crucial for accurate characterization .

Molecular Phenotyping: Analysis of defense-related gene expression, callose deposition, and other molecular markers of resistance can provide additional evidence for MLO dysfunction.

Protein Expression and Localization Studies: Assessing whether mutations affect protein stability, subcellular localization, or membrane insertion can provide mechanistic insights into how specific mutations confer resistance.

The complementary use of these validation techniques provides a comprehensive understanding of how specific MLO mutations affect powdery mildew susceptibility, helping to identify the most promising candidates for crop improvement.

How do MLO-mediated resistance mechanisms compare between barley and wheat?

The MLO-mediated resistance mechanisms share fundamental similarities between barley and wheat but with important species-specific differences:

Functional Conservation: The high sequence identity (approximately 89%) between barley and wheat MLO proteins suggests conserved functions . This is supported by the ability of wheat TaMlo-B1 to complement powdery mildew-resistant barley mlo mutants at the single-cell level .

Genetic Complexity: The hexaploid nature of bread wheat presents a unique challenge compared to diploid barley. While a single functional mlo mutation can confer resistance in barley, wheat has three MLO homoeologues (TaMlo-A1, TaMlo-B1, and TaMlo-D1), each with two alleles . This genetic redundancy likely explains why natural wheat mlo mutants have not been reported - multiple mutations would be needed for a detectable resistance phenotype .

Pleiotropic Effects: The pleiotropic effects of MLO mutations, including spontaneous cell death and premature senescence, have been well-documented in barley . Interestingly, some wheat lines with mutations in multiple TaMlo homoeologues showed enhanced resistance without discernible pleiotropic phenotypes, suggesting potential advantages of the wheat system for agricultural applications .

These comparisons highlight how knowledge from the well-studied barley MLO system can be translated to wheat, while acknowledging the unique genetic and physiological context of each species.

What are the future prospects for developing non-transgenic powdery mildew-resistant wheat varieties using MLO mutations?

The development of non-transgenic powdery mildew-resistant wheat varieties using MLO mutations shows considerable promise:

TILLING Approach Advantages: TILLING technology provides a non-transgenic approach to generating and selecting partial loss-of-function alleles of TaMlo, circumventing regulatory and public acceptance issues associated with transgenic crops . This makes the resulting varieties potentially more acceptable for commercial deployment worldwide.

Progress with Stacked Mutations: Researchers have already generated four independent wheat lines with non-conservative mutations in each of the three TaMlo homoeologues . Both homozygous triple mutant lines and some homozygous double mutant lines showed enhanced powdery mildew resistance without discernible pleiotropic phenotypes .

Incomplete but Useful Resistance: While the resistance observed in these lines is incomplete (compared to the near-immunity in barley mlo mutants), it represents a significant improvement over wild-type susceptibility. This partial resistance may actually be advantageous in avoiding strong selection pressure on the pathogen that could lead to resistance breakdown.

Combining with Other Resistance Mechanisms: MLO-based resistance could be pyramided with other resistance genes or mechanisms to achieve more durable and potentially complete protection against powdery mildew.

Future Research Directions: Further studies will likely focus on:

  • Identifying optimal combinations of TaMlo mutations that maximize resistance while minimizing yield penalties

  • Exploring MLO mutations in diverse wheat germplasm to assess genetic background effects

  • Field testing under various environmental conditions to evaluate durability and stability of resistance

  • Investigating the interaction of mlo-mediated resistance with other disease resistances

The non-transgenic wheat lines with enhanced powdery mildew resistance generated through TILLING represent "an important step towards the production of commercial non-transgenic, powdery mildew-resistant bread wheat varieties" , offering significant potential for sustainable disease management in this crucial global food crop.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.