Recombinant Hordeum vulgare NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

The recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (NDH subunit 3), is a plant-specific protein expressed in E. coli as a full-length recombinant construct. It belongs to the chloroplast NADH dehydrogenase (NDH) complex, which facilitates cyclic electron transport (CET) in photosynthesis. This subunit is critical for proton translocation and electron transfer within the NDH complex, mediating interactions with plastoquinone (PQ) and NAD(P)H .

Functional Role in the Chloroplast NDH Complex

NDH Complex Architecture
The NDH complex in Hordeum vulgare is a 29-subunit supercomplex that interacts with photosystem I (PSI) to form the PSI-NDH supercomplex. Subunit 3 is part of the core structure, contributing to:

  • Proton Translocation: Coordinates with subunits 4L, 6, H, and I to pump protons across the thylakoid membrane .

  • Electron Transfer: Mediates NAD(P)H oxidation and plastoquinone reduction, essential for CET .

Structural Insights from Cryo-EM
A 3.7 Å cryo-EM structure of the PSI-NDH supercomplex reveals:

  • Subunit 3 Position: Embedded in the NDH core, adjacent to subunits 4L and 6, forming a hydrophobic channel for quinone binding .

  • Interactions: Stabilizes the quinone-binding pocket through aromatic residues (e.g., Trp, Phe) and hydrogen bonds .

Recombinant Production and Applications

Production Protocol

StepDetails
CloningFull-length gene (1–120 aa) cloned into bacterial expression vectors
ExpressionInduced in E. coli under optimized conditions (e.g., 16–25°C, IPTG)
PurificationNi-NTA affinity chromatography (via His tag), followed by gel filtration
Storage-20°C in Tris-based buffer with 50% glycerol

Applications

  • ELISA Kits: Used as an antigen in immunoassays to detect antibodies or protein interactions .

  • Functional Studies: Investigates quinone-binding kinetics and redox activity in vitro .

  • Structural Biology: Crystallization trials for high-resolution X-ray structures (limited to date) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEPMGGAWVQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H dehydrogenase) functions as an electron shuttle, transferring electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what is its primary function in barley chloroplasts?

NAD(P)H-quinone oxidoreductase is an enzyme that catalyzes the transfer of electrons from NAD(P)H to quinones. In barley chloroplasts, this enzyme plays a crucial role in the prenylquinone metabolism pathway. The enzyme specifically reduces plastoquinone and is essential for maintaining the redox state of the plastoquinone pool in chloroplasts . Type II NAD(P)H quinone oxidoreductases, like the one found in barley chloroplasts, catalyze the two-electron reduction of various quinones, which is essential for detoxification processes and redox balance maintenance within the plant cell .

How does the chloroplastic NAD(P)H-quinone oxidoreductase differ from mitochondrial isoforms?

The chloroplastic NAD(P)H-quinone oxidoreductase (such as NDC1) differs from mitochondrial isoforms in several key aspects:

  • Subcellular localization: Chloroplastic forms are associated with plastoglobules (lipid droplets in chloroplasts), while mitochondrial forms are located in the inner mitochondrial membrane .

  • Substrate specificity: Chloroplastic enzymes preferentially reduce plastoquinone, while mitochondrial isoforms have different quinone specificities .

  • Evolutionary origin: Studies in Arabidopsis have shown that chloroplastic and mitochondrial NAD(P)H dehydrogenases have different evolutionary origins and show distinct responses to light .

  • Physiological role: The chloroplastic enzyme is involved in prenylquinone metabolism and vitamin K1 (phylloquinone) accumulation, whereas mitochondrial forms participate in alternative respiratory pathways .

What roles does NAD(P)H-quinone oxidoreductase play in plant stress responses?

NAD(P)H-quinone oxidoreductase plays several important roles in plant stress responses:

  • Oxidative stress protection: The enzyme helps protect plants from oxidative stress by reducing quinones that could otherwise participate in reactive oxygen species (ROS) generation .

  • Detoxification of harmful compounds: Similar to the function observed in other organisms, plant NAD(P)H-quinone oxidoreductases can detoxify harmful synthetic compounds encountered during environmental stress .

  • Maintenance of redox balance: By reducing the plastoquinone pool, the enzyme helps maintain cellular redox homeostasis during stress conditions .

  • Support for vitamin synthesis: The enzyme is essential for the production of vitamin K1 and contributes to plastochromanol-8 accumulation, both of which have antioxidant properties that help plants cope with stress .

What are the optimal conditions for expressing recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase subunit 3?

For optimal expression of recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase subunit 3, researchers should consider the following methodological approaches:

  • Expression system selection: Based on similar proteins studied, prokaryotic expression systems using E. coli BL21(DE3) strains have shown good results for soluble expression of plant oxidoreductases .

  • Temperature optimization: Lower induction temperatures (16-20°C) often yield better results for functional expression of plant chloroplastic proteins compared to standard conditions (37°C) .

  • Co-expression with chaperones: When expressing chloroplastic proteins, co-expression with molecular chaperones can improve proper folding and solubility.

  • Inclusion of appropriate tags: N-terminal His-tags have been successfully used for purification of similar oxidoreductases, allowing for metal affinity chromatography purification .

  • Buffer optimization: For functional activity, the purified protein should be maintained in buffers containing stabilizing agents (like glycerol) and reducing agents (like DTT or β-mercaptoethanol) to maintain the enzyme in its active form .

What analytical methods are most effective for characterizing the activity of recombinant NAD(P)H-quinone oxidoreductase?

Several analytical methods have proven effective for characterizing the activity of recombinant NAD(P)H-quinone oxidoreductase:

  • Spectrophotometric assays: The most common method involves monitoring the decrease in NADPH absorbance at 340 nm during the enzyme-catalyzed reaction with various quinone substrates . This provides a direct measure of enzyme activity.

  • HPLC analysis: For studying the product formation and substrate specificity, HPLC analysis of prenylquinones (plastoquinone, phylloquinone, etc.) provides valuable information about the enzyme's function in vivo .

  • Enzyme kinetics studies: Determining kinetic parameters (Km, Vmax, kcat) with different substrates helps characterize the enzyme's substrate preferences and catalytic efficiency .

  • Crystal structure analysis: X-ray crystallography of the enzyme-NADPH complex at high resolution (e.g., 2.0-2.4 Å) provides detailed information about the structure-function relationship .

  • Site-directed mutagenesis: Targeted mutation of key residues identified through computational simulation or sequence alignment helps identify catalytically important amino acids and enzyme mechanisms .

How does the substrate specificity of Hordeum vulgare NAD(P)H-quinone oxidoreductase compare with homologs from other species?

The substrate specificity of Hordeum vulgare NAD(P)H-quinone oxidoreductase shows both similarities and differences compared to homologs from other species:

  • Substrate size preferences: Similar to the Phytophthora capsici QOR, the barley enzyme likely accommodates larger quinone substrates like 9,10-phenanthrenequinone more efficiently than smaller ones like 1,4-benzoquinone .

  • Structural determinants: The active site architecture influences substrate specificity. Key residues like those equivalent to R45, Q48, Y54, C147, and T148 in the P. capsici enzyme likely play crucial roles in substrate binding in the barley enzyme as well .

  • Species-specific variations: While the general topology is conserved among homologous structures, the active sites vary, indicating differences in substrate specificities between species .

  • Quinone-binding channel: Computational simulation and site-directed mutagenesis studies with other QORs have identified specific quinone-binding channels that determine substrate specificity . The barley enzyme likely has a unique architecture for this channel that determines its specific quinone preferences.

What role does the NAD(P)H-quinone oxidoreductase play in vitamin K1 biosynthesis in chloroplasts?

NAD(P)H-quinone oxidoreductase plays an essential role in vitamin K1 (phylloquinone) biosynthesis in chloroplasts:

What are the best isolation techniques for obtaining pure, active recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase?

For isolating pure, active recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase, the following purification strategy is recommended:

  • Affinity chromatography: Using His-tagged recombinant protein, Ni-NTA affinity chromatography provides an effective first purification step .

  • Size-exclusion chromatography: A secondary purification step using gel filtration helps remove aggregates and provides information about the oligomeric state of the protein in solution. Similar enzymes have been found to exist as tetramers .

  • Ion-exchange chromatography: For further purification, ion-exchange chromatography can separate the target protein from contaminants with different charge properties.

  • Buffer optimization: Throughout purification, buffers containing stabilizing agents (10-15% glycerol) and reducing agents (1-5 mM DTT or β-mercaptoethanol) help maintain enzyme activity .

  • Activity preservation: Keeping the purification process at 4°C and minimizing the time between purification steps helps preserve enzyme activity.

  • Purity assessment: SDS-PAGE analysis with Coomassie staining should be used to assess protein purity, with >95% purity typically required for crystal structure studies .

How can researchers effectively study the interaction between NAD(P)H-quinone oxidoreductase and its substrates?

To effectively study the interaction between NAD(P)H-quinone oxidoreductase and its substrates, researchers can employ several complementary approaches:

  • Enzyme kinetics: Determining kinetic parameters (Km, Vmax) for different substrates provides quantitative information about substrate preferences and binding affinity .

  • Crystal structure analysis: X-ray crystallography of the enzyme complexed with NADPH and various quinone substrates reveals detailed binding interactions .

  • Computational simulation: Molecular docking and molecular dynamics simulations can predict quinone binding modes and identify potential binding channels .

  • Site-directed mutagenesis: Mutation of residues predicted to be involved in substrate binding, followed by activity assays, can confirm their functional importance .

  • Spectroscopic analyses: Fluorescence quenching studies and circular dichroism can provide information about substrate binding and protein conformational changes.

  • Isothermal titration calorimetry (ITC): This technique provides thermodynamic parameters of substrate binding, offering insights into binding affinity and stoichiometry.

What experimental approaches can be used to study the role of NAD(P)H-quinone oxidoreductase in prenylquinone metabolism?

Several experimental approaches can effectively elucidate the role of NAD(P)H-quinone oxidoreductase in prenylquinone metabolism:

  • Knockout/knockdown studies: Generation of plants with reduced or eliminated expression of the enzyme, followed by analysis of prenylquinone profiles, reveals its physiological role .

  • HPLC analysis of prenylquinones: Quantification of plastoquinone, plastochromanol-8, phylloquinone, and tocopherol levels in wild-type versus mutant plants provides direct evidence of the enzyme's role in their metabolism .

  • Redox state analysis: Determining the ratio of oxidized to reduced forms of plastoquinone in plastoglobules helps understand the enzyme's role in maintaining the plastoquinone redox state .

  • In vitro enzyme assays: Reconstitution of the enzyme with various prenylquinone substrates helps determine its substrate specificity and catalytic capacity .

  • Subcellular localization studies: Immunogold labeling and fluorescent protein fusions can confirm the association of the enzyme with plastoglobules, supporting its role in prenylquinone metabolism .

  • Complementation experiments: Introducing the wild-type gene into knockout mutants should restore normal prenylquinone profiles if the enzyme is directly involved in their metabolism .

How has the NAD(P)H-quinone oxidoreductase gene family evolved across plant species?

The evolution of the NAD(P)H-quinone oxidoreductase gene family across plant species shows several interesting patterns:

What are the key structural differences between NAD(P)H-quinone oxidoreductases from monocots versus dicots?

The structural differences between NAD(P)H-quinone oxidoreductases from monocots (like Hordeum vulgare) and dicots include:

  • Substrate binding pocket: Variations in the amino acid composition of the substrate-binding pocket affect substrate specificity between monocot and dicot enzymes .

  • Quaternary structure: While the basic bi-modular architecture containing a NADPH-binding groove and a substrate-binding pocket is conserved, the oligomeric state and intermolecular interactions may differ between monocot and dicot enzymes .

  • Regulatory elements: Differences in regulatory elements in the gene promoters between monocots and dicots result in differential expression patterns in response to environmental stresses.

  • Post-translational modifications: Variation in conserved sites for post-translational modifications can affect enzyme activity and regulation across plant lineages.

  • Subcellular targeting: Subtle differences in transit peptides may influence the efficiency of chloroplast targeting and sub-organellar localization between monocot and dicot enzymes.

How does the barley NAD(P)H-quinone oxidoreductase relate to similar enzymes involved in disease resistance?

The relationship between barley NAD(P)H-quinone oxidoreductase and enzymes involved in disease resistance presents several interesting connections:

  • Detoxification capacity: Similar to the observed function in Phytophthora capsici, NAD(P)H-quinone oxidoreductases can help detoxify harmful chemicals encountered during pathogen invasion .

  • Redox signaling: The enzyme's role in maintaining redox balance may contribute to signaling pathways involved in disease resistance responses.

  • Resistance gene proximity: In barley, mapping studies have identified disease resistance genes like RphMBR1012 that confer resistance to pathogens like Puccinia hordei . While not directly linked in the current research, the oxidoreductase may function in metabolic pathways that support these resistance mechanisms.

  • Stress response integration: The enzyme's involvement in prenylquinone metabolism connects it to antioxidant production, which is often upregulated during pathogen attack.

What are the major technical challenges in studying recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase?

Researchers face several significant technical challenges when studying recombinant Hordeum vulgare NAD(P)H-quinone oxidoreductase:

  • Maintaining enzyme activity: Preserving the native activity of the recombinant enzyme throughout expression and purification processes remains challenging, as the enzyme can lose activity due to improper folding or oxidation .

  • Substrate availability: Some of the natural substrates, particularly plant-specific prenylquinones, are not commercially available and must be isolated from plant material or chemically synthesized.

  • Crystallization difficulties: Obtaining high-quality crystals for structure determination can be challenging, especially for membrane-associated proteins like those found in plastoglobules .

  • Heterologous expression: Expressing plant chloroplastic proteins in bacterial systems may result in improper folding or lack of essential post-translational modifications.

  • Functional reconstitution: Recreating the native lipid environment of plastoglobules for functional studies is technically demanding .

What emerging technologies could advance our understanding of NAD(P)H-quinone oxidoreductase function in vivo?

Several emerging technologies hold promise for advancing our understanding of NAD(P)H-quinone oxidoreductase function in vivo:

  • CRISPR-Cas9 genome editing: Precise modification of the enzyme gene in barley can create targeted mutations to study specific functional domains without disrupting the entire gene.

  • Cryo-electron microscopy: This technique could help resolve the structure of the enzyme in its native membrane environment or in association with plastoglobules .

  • Super-resolution microscopy: Advanced imaging techniques can visualize the dynamic localization of the enzyme within chloroplasts during various stress conditions.

  • Metabolomics approaches: Comprehensive analysis of prenylquinone metabolism using high-resolution mass spectrometry can reveal the full spectrum of substrates and products associated with the enzyme's activity .

  • Protein-protein interaction proteomics: Techniques like proximity labeling can identify the enzyme's interaction partners in vivo, revealing its integration into broader metabolic networks.

  • Single-molecule enzymology: These techniques can reveal heterogeneity in enzyme behavior and capture transient states in the catalytic cycle that are missed by bulk measurements.

What potential applications could arise from understanding barley NAD(P)H-quinone oxidoreductase's structure and function?

Understanding the structure and function of barley NAD(P)H-quinone oxidoreductase could lead to several valuable applications:

  • Improved crop stress tolerance: Engineering plants with optimized NAD(P)H-quinone oxidoreductase activity could enhance tolerance to oxidative stress and improve crop yield under adverse conditions .

  • Enhanced vitamin production: Since the enzyme is essential for vitamin K1 production and influences other prenylquinones, understanding its function could lead to biofortification strategies for increased vitamin content in crops .

  • Biocatalyst development: The enzyme's ability to reduce various quinones could be harnessed for biocatalytic applications in green chemistry .

  • Physiological pathway engineering: With detailed knowledge of the enzyme's role in prenylquinone metabolism, metabolic engineering approaches could redirect plastid metabolism toward valuable compounds .

  • Disease resistance enhancement: If the enzyme contributes to pathogen defense mechanisms, this understanding could be applied to developing crops with improved disease resistance .

What statistical approaches are most appropriate for analyzing NAD(P)H-quinone oxidoreductase activity data?

For analyzing NAD(P)H-quinone oxidoreductase activity data, the following statistical approaches are recommended:

  • Enzyme kinetics modeling: Nonlinear regression analysis to fit activity data to Michaelis-Menten, Lineweaver-Burk, or more complex models that account for substrate inhibition or allosteric effects .

  • ANOVA: For comparing enzyme activity under different conditions or with different substrates, analysis of variance with appropriate post-hoc tests (Tukey's HSD, Bonferroni) should be used .

  • Multivariate analysis: When examining multiple factors affecting enzyme activity (pH, temperature, substrate concentration), multivariate approaches like principal component analysis or response surface methodology can provide insights into complex relationships.

  • Bootstrap methods: For robust estimation of kinetic parameters when working with limited replicates or non-normally distributed data.

  • Paired statistical tests: When comparing wild-type and mutant enzyme activities, paired t-tests or Wilcoxon signed-rank tests provide appropriate statistical power.

How can researchers reconcile contradictory findings about NAD(P)H-quinone oxidoreductase function across different studies?

Researchers can address contradictory findings about NAD(P)H-quinone oxidoreductase function through several methodological approaches:

  • Standardization of experimental conditions: Differences in enzyme preparation, assay conditions, or substrate quality can significantly affect results. Establishing standardized protocols for enzyme activity assays is crucial .

  • Consideration of genetic variability: Different barley varieties may have allelic variations in the enzyme gene, leading to functional differences. Genetic background should be clearly reported and considered in comparisons .

  • Isoform specificity: Ensuring that studies are specifically addressing the chloroplastic subunit 3 rather than other NAD(P)H-quinone oxidoreductase isoforms is essential for meaningful comparisons .

  • Comprehensive literature review: Systematic reviews that analyze methodological differences between contradictory studies can help identify sources of variation.

  • Collaborative validation: Independent replication of key findings by multiple laboratories using standardized materials and methods can resolve contradictions.

  • Meta-analysis: Statistical combination of results from multiple studies can provide a more robust understanding of the enzyme's function and identify factors that explain between-study heterogeneity.

What are the key considerations when interpreting in vitro versus in vivo data for NAD(P)H-quinone oxidoreductase activity?

When interpreting in vitro versus in vivo data for NAD(P)H-quinone oxidoreductase activity, several key considerations should be addressed:

  • Physiological relevance of substrates: In vitro studies often use model substrates like menadione or artificial quinones that may not reflect the natural substrates encountered in chloroplasts .

  • Cellular compartmentalization: The enzyme's association with plastoglobules in vivo creates a unique microenvironment that is difficult to replicate in vitro .

  • Redox state differences: The cellular redox environment in vivo may significantly differ from in vitro conditions, affecting enzyme activity and substrate availability .

  • Protein-protein interactions: In vivo, the enzyme likely functions within a complex network of interacting proteins that can modulate its activity .

  • Substrate accessibility: In vivo, substrate concentrations and accessibility may be limited by compartmentalization, membrane barriers, or competition with other enzymes.

  • Post-translational modifications: The enzyme may undergo post-translational modifications in vivo that affect its activity but are absent in recombinant systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.