Recombinant Hordeum vulgare Photosystem I reaction center subunit XI, chloroplastic (PSAL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize your request.
Synonyms
PSAL; Photosystem I reaction center subunit XI, chloroplastic; PSI-L; PSI subunit V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
41-209
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
PSAL
Target Protein Sequence
AVKSDKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLA HGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLT LTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFFK
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of PSAL in photosystem I complexes?

PSAL (Photosystem I reaction center subunit XI) serves as an integral component of the photosystem I (PSI) complex in barley (Hordeum vulgare). This protein plays a crucial structural role in the organization and stabilization of the PSI complex. Specifically, PSAL contributes to maintaining the spatial arrangement of chlorophyll molecules and other cofactors within the PSI reaction center. The protein is encoded by the chloroplast genome and is integrated into the thylakoid membrane as part of the PSI supercomplex. In barley PSI-LHCI-Lhca5 supercomplex, PSAL works alongside numerous other subunits to facilitate efficient light harvesting and electron transport during photosynthesis . The functional significance of PSAL becomes evident when examining high-resolution structural studies of PSI complexes, which reveal its positioning and interactions with other subunits to maintain the three-dimensional architecture necessary for photosynthetic function.

What techniques are commonly used to express recombinant PSAL?

Expression of recombinant PSAL from Hordeum vulgare typically employs molecular biology techniques optimized for chloroplast proteins. The preferred methodology involves cloning the PSAL gene into expression vectors containing appropriate promoters for either prokaryotic or eukaryotic expression systems. For prokaryotic expression, modified E. coli strains capable of proper membrane protein folding (such as C41/C43 or BL21-CodonPlus) are commonly utilized with induction at lower temperatures (16-18°C) to facilitate proper folding of this membrane-associated protein. For more native-like expression, researchers frequently turn to chloroplast transformation systems, similar to the approach described for PsaB in Chlamydomonas reinhardtii studies, where His-tagging strategies facilitate purification . The transformation protocol typically involves biolistic delivery of transformation constructs, followed by selection on appropriate antibiotics. Expression optimization requires careful consideration of growth conditions, including light intensity, which is generally maintained at lower levels (approximately 20 μmol photons m⁻² s⁻¹) to prevent photodamage while ensuring proper protein integration into thylakoid membranes . Post-expression purification typically employs gentle detergent solubilization of membranes followed by affinity chromatography.

What is the role of PSAL in mediating PSI interactions with the NDH complex?

Recent structural studies have revealed that PSI can form a supercomplex with the NADH dehydrogenase-like (NDH) complex, which plays a crucial role in cyclic electron flow. In barley, the PSI-NDH supercomplex comprises two copies of the PSI-light-harvesting complex I (LHCI) subcomplex and one NDH complex . While the primary mediators of this interaction are the monomeric LHCI proteins Lhca5 and Lhca6, PSAL may contribute to the structural framework necessary for these interactions. The positioning of PSAL within the PSI complex potentially influences the docking sites available for NDH association. This interaction is particularly significant as the PSI-NDH-dependent cyclic electron transport (CET) represents a crucial adaptive mechanism for plants under various stress conditions. The structural arrangement within this supercomplex, composed of at least 29 NDH subunits and multiple PSI components, creates a sophisticated machinery for fine-tuning electron transport . Understanding PSAL's contribution to these supramolecular assemblies provides insights into the structural determinants of photosynthetic efficiency under varying environmental conditions and energy demands.

How do post-translational modifications affect PSAL function in the PSI complex?

Post-translational modifications (PTMs) of PSAL represent a sophisticated regulatory mechanism affecting its integration and function within the PSI complex. Phosphorylation appears to be the most prominent PTM affecting PSAL, with specific phosphorylation sites modulating its interaction with other PSI subunits and potentially influencing the dynamics of photosystem assembly and repair. Under high-light conditions, the phosphorylation state of photosystem components, including PSAL, undergoes significant changes, suggesting a role in stress adaptation . Quantitative analysis of protein abundance under varying light conditions reveals that phosphorylation-dependent regulation contributes to the light acclimation response. Additionally, other PTMs including acetylation and methylation may influence the stability and turnover rate of PSAL within the thylakoid membrane. The pattern of these modifications can vary between species and under different environmental conditions, adding a layer of complexity to photosystem regulation. Methodologically, identifying these PTMs requires sophisticated mass spectrometry approaches, often coupled with enrichment strategies specific for different modification types.

What is the optimal protocol for purifying recombinant PSAL for structural studies?

Purification of recombinant PSAL for high-resolution structural studies requires a carefully optimized protocol that preserves the native structure while yielding sufficient quantities of pure protein. The following methodology has proven effective:

Purification Protocol:

  • Membrane Isolation: Harvest cells expressing recombinant His-tagged PSAL and disrupt using a French press or sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 400 mM sucrose, 10 mM MgCl₂, and protease inhibitor cocktail.

  • Thylakoid Membrane Solubilization: Solubilize isolated thylakoid membranes using a gentle detergent, preferably n-dodecyl-α-D-maltoside (α-DDM) at 1% (w/v) as utilized in successful PSI purification studies . Incubate for 30 minutes on ice with gentle agitation.

  • Affinity Purification: Apply the solubilized material to Ni-NTA or similar affinity resin, wash extensively with buffer containing 0.02% α-DDM and increasing imidazole concentrations (10-30 mM), and elute with 250 mM imidazole.

  • Size Exclusion Chromatography: Further purify using size exclusion chromatography on a Superdex 200 column equilibrated with buffer containing 20 mM HEPES (pH 7.5), 150 mM NaCl, and 0.02% α-DDM.

  • Sucrose Density Gradient Centrifugation: For separation of protein complexes containing PSAL, apply the sample to a 10-40% sucrose gradient and centrifuge at 200,000 × g for 16 hours .

This protocol typically yields protein of >95% purity suitable for structural studies, with the critical steps being the choice of detergent and careful maintenance of the cold chain throughout the procedure to prevent protein denaturation.

How can I assess the functional integrity of purified recombinant PSAL?

Evaluating the functional integrity of purified recombinant PSAL requires a multi-faceted approach that examines both structural integrity and functional capacity within the photosynthetic electron transport chain. A comprehensive assessment protocol should include the following complementary techniques:

  • Circular Dichroism (CD) Spectroscopy: This technique provides information on the secondary structure content, confirming proper folding of the purified PSAL protein. The characteristic spectrum of properly folded PSAL will show typical α-helical features.

  • Absorption Spectroscopy: Properly associated chlorophyll molecules will show characteristic absorption peaks. Any shifts in these peaks may indicate alterations in pigment-protein interactions.

  • Immunoblot Analysis: Using specific antibodies against PSAL, quantify the protein abundance relative to other PSI components, similar to the semi-quantitative approach used for PsaA analysis, utilizing dilution series of wild-type samples as standards .

  • PSI Reconstitution Assays: Assess the ability of purified PSAL to incorporate into PSI complexes using reconstitution experiments followed by functional evaluation.

  • P700 Oxidation Measurements: Similar to the approach described for Chlorella species, measure maximal P700 oxidation on a chlorophyll basis to assess electron transfer functionality within reconstituted complexes .

  • Functional Antenna Size Determination: Evaluate the impact of PSAL incorporation on the functional antenna size of PSI complexes to determine if the light-harvesting properties are maintained .

These combined approaches provide a comprehensive assessment of both structural integrity and functional capacity, ensuring that the purified recombinant PSAL retains its native properties.

What cryo-EM sample preparation techniques are most effective for PSAL-containing complexes?

Successful cryo-EM analysis of PSAL-containing complexes requires meticulous sample preparation to preserve the native structure while achieving optimal particle distribution. Based on successful approaches used for PSI complex studies, the following protocol is recommended:

  • Grid Selection and Preparation: Use Quantifoil R1.2/1.3 holey carbon grids with an additional thin continuous carbon film. Treat grids with glow discharge in a hydrophilic environment (air) for 30 seconds at 15 mA.

  • Sample Concentration Optimization: Adjust protein concentration to approximately 0.5-1.0 mg/ml in buffer containing 20 mM HEPES (pH 7.5), 150 mM NaCl, and 0.02% α-DDM. This concentration range typically yields an optimal particle distribution.

  • Vitrification Procedure: Apply 3-4 μl of sample to the grid, blot for 3-5 seconds using filter paper at 4°C and 100% humidity, and plunge-freeze in liquid ethane cooled by liquid nitrogen using an automated vitrification device such as Vitrobot.

  • Crosslinking Consideration: For complex stabilization, consider implementing the crosslinking approach using chemically activated electron donors such as plastocyanin, which has proven effective in stabilizing PSI complexes for structural studies .

  • Data Collection Parameters: Collect data at a pixel size of approximately 0.5-0.6 Å, with defocus ranges from -1.0 to -3.0 μm, using low-dose conditions (approximately 50 e⁻/Ų) to minimize radiation damage.

The subsequent processing workflow should include reference-free 2D classification to separate different oligomeric states, followed by 3D classification and refinement. For PSI complexes containing PSAL, implementing C2 symmetry for dimeric forms has proven successful in achieving high-resolution structures .

How should I analyze protein-protein interactions between PSAL and other PSI components?

Analysis of protein-protein interactions between PSAL and other PSI components requires an integrated approach combining structural data with biochemical validation. The following analytical workflow is recommended:

Analytical Protocol:

  • Structural Interface Mapping: Utilize high-resolution cryo-EM or X-ray crystallography data (such as the 3.4 Å resolution structure of barley PSI-LHCI-Lhca5 supercomplex ) to identify potential interaction interfaces between PSAL and neighboring proteins. Focus on residues within 4 Å of adjacent subunits, which typically represent direct interaction points.

  • Computational Analysis: Employ molecular dynamics simulations to evaluate the stability of these interactions and calculate binding energies. This approach can identify key residues contributing to interface stability.

  • Cross-linking Mass Spectrometry (XL-MS): Perform chemical cross-linking experiments using reagents of defined spacer lengths (e.g., DSS, BS3) followed by mass spectrometry analysis to identify specific residues involved in interactions, validating computational predictions.

  • Mutagenesis Validation: Design site-directed mutagenesis experiments targeting key interface residues identified through structural and computational approaches. Evaluate the impact on complex stability and function.

  • Co-immunoprecipitation Assays: Use antibodies against PSAL to pull down associated proteins, followed by mass spectrometry or immunoblot analysis to identify interaction partners under various physiological conditions.

The data from these complementary approaches should be integrated into a comprehensive interaction model, potentially visualized using molecular graphics software. This integrated analysis provides robust evidence for specific interaction points between PSAL and other PSI components, informing structure-function relationships within the complex.

What statistical approaches are appropriate for analyzing PSAL expression under different environmental conditions?

Statistical analysis of PSAL expression under varying environmental conditions requires robust approaches that account for biological variability while detecting meaningful differences. Based on published methodologies, the following statistical framework is recommended:

Statistical Analysis Framework:

  • Experimental Design Considerations: Implement a minimum of three biological replicates for each condition tested, with technical replicates as appropriate for the quantification method. This approach aligns with published protocols that report means with standard deviations across biological replicates .

  • Normalization Strategies: Normalize PSAL expression data to an appropriate reference point. For immunoblot analyses, this might involve normalization to total chlorophyll content or to constitutively expressed proteins. For transcriptomic data, validated reference genes specific to the experimental conditions should be employed.

  • Statistical Tests:

    • For comparing two conditions: Conduct Student's t-tests with appropriate checks for normality and equal variance assumptions.

    • For multiple condition comparisons: Implement ANOVA followed by post-hoc tests (e.g., Tukey's HSD) to identify specific differences between conditions.

    • Significance levels should be clearly indicated, with p-values < 0.05 and < 0.01 typically denoted with single and double asterisks, respectively .

  • Multivariate Analysis: When analyzing PSAL expression alongside other photosystem components, consider principal component analysis (PCA) or hierarchical clustering to identify coordinated expression patterns.

  • Ratio Calculations: For comparing PSAL abundance in relation to other proteins (e.g., PSI/PSII ratios), use densitometry of immunoblot signals as demonstrated for Chlorella species . This approach should include appropriate controls and standardization.

  • Data Visualization: Present data using bar graphs with error bars representing standard deviation or standard error, clearly indicating sample size and statistical significance.

This comprehensive statistical framework ensures robust analysis of experimental data, facilitating meaningful interpretation of PSAL expression responses to environmental variables.

How can I compare PSAL integration efficiency across different expression systems?

Comparing PSAL integration efficiency across different expression systems requires standardized methodology that accounts for system-specific variables while providing comparable metrics. The following analytical approach is recommended:

Comparison Framework:

  • Quantification Metrics:

    • Absolute Quantification: Use purified PSAL standards to generate calibration curves for Western blot or mass spectrometry quantification, expressing results as μg PSAL per mg total protein or per mg chlorophyll.

    • Relative Quantification: Express PSAL abundance as a percentage of total PSI proteins, facilitating comparison across systems regardless of absolute expression levels.

  • Integration Assessment:

    Integration ParameterMeasurement TechniqueUnit of Measure
    Membrane LocalizationMembrane fractionation followed by immunoblotting% of total PSAL in membrane fraction
    Complex AssociationBlue native PAGE followed by Western blot% of PSAL in assembled complexes
    Functional IntegrationP700 oxidation measurementsΔabsorbance/mg chlorophyll
    Chlorophyll AssociationAbsorption spectroscopyChlorophyll molecules per PSAL
  • System Normalization: Account for system-specific variables by normalizing to internal standards appropriate for each expression system. For chloroplast-based systems, this might involve chlorophyll content, while for bacterial systems, total membrane protein might be more appropriate.

  • Statistical Validation: Conduct paired statistical analyses across expression systems, using matched conditions where possible. ANOVA with post-hoc tests is typically appropriate for multi-system comparisons.

  • Integration Efficiency Index: Develop a composite index incorporating multiple parameters:

    Integration Efficiency = (% Membrane Localization × % Complex Association × Functional Activity) / 100²

This standardized approach allows objective comparison of PSAL integration efficiency across diverse expression systems, from bacterial to algal to plant-based platforms, providing valuable insights for optimization of recombinant production strategies.

How does PSAL contribute to PSI stability under high light stress conditions?

Under high light stress conditions, PSAL plays a multifaceted role in maintaining PSI stability and function. Experimental evidence indicates that high light exposure leads to differential accumulation of photosystem proteins, with quantitative analysis revealing that most tested proteins, including core components like PsaA, show highest accumulation under high-light conditions . PSAL contributes to this adaptive response through several mechanisms:

First, PSAL appears to stabilize the structural integrity of the PSI complex under excessive excitation pressure. Its strategic positioning within the complex helps maintain proper spatial organization of cofactors, particularly the chlorophyll molecules most susceptible to photooxidative damage. Second, PSAL may participate in photoprotective energy dissipation mechanisms. The protein's association with specific chlorophyll molecules positions it to potentially influence excitation energy distribution under high light, helping to prevent over-excitation of the reaction center. Third, PSAL might facilitate rapid turnover and repair of photodamaged PSI components. Under high light conditions, increased accumulation of PSI proteins suggests enhanced repair capacity, with PSAL potentially serving as a stable scaffold during component replacement . This complex photoprotective role makes PSAL an important target for engineering photosynthetic organisms with enhanced stress tolerance.

What is the relationship between PSAL and cyclic electron flow optimization?

The relationship between PSAL and CEF optimization manifests in several functional aspects. First, PSAL's role in maintaining PSI structural integrity indirectly supports efficient docking of electron carriers involved in CEF, including ferredoxin and plastocyanin. Second, the position of PSAL relative to other PSI subunits creates a microenvironment that can influence the redox properties of nearby cofactors, potentially affecting electron transfer kinetics. Third, under conditions requiring enhanced CEF (such as high light or drought stress), the stability of PSAL-containing PSI complexes becomes particularly critical for maintaining this alternative electron flow pathway . The intricate architecture of the PSI-NDH supercomplex, including the precise positioning of all components including PSAL, provides the structural basis for understanding how plants regulate the balance between linear and cyclic electron flow under varying environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.