Recombinant Hordeum vulgare Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing that specific tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAATHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVNYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTKKQAV
Uniprot No.

Target Background

Function
CP47 is a core component of the photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient that subsequently powers ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein and what role does it play in Photosystem II?

CP47 (encoded by the psbB gene) is an essential core antenna protein of Photosystem II (PSII), serving as an internal light-harvesting component that transfers excitation energy to the reaction center. It is a transmembrane protein that binds multiple chlorophyll molecules and plays a crucial structural role in the organization of PSII.

The CP47 protein functions within the larger PSII complex, which is responsible for the water-splitting reaction in photosynthesis. CP47 interacts with multiple subunits, including PsbO, which is essential for maintaining the oxygen-evolving complex . The protein contains several transmembrane helices and binds approximately 16 chlorophyll molecules, facilitating energy transfer from peripheral antenna complexes to the reaction center.

What expression systems are most effective for producing recombinant Hordeum vulgare CP47?

Based on extensive research with similar photosynthetic proteins, E. coli remains the most widely used expression system for recombinant proteins including CP47. While the search results don't specifically address CP47 expression, the principles of recombinant protein expression can be applied.

For optimal expression of membrane proteins like CP47, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results than standard BL21(DE3) strains. These specialized strains can accommodate the toxicity often associated with overexpressing membrane proteins .

To determine optimal expression conditions, researchers should implement a multivariate experimental design approach rather than testing one variable at a time. This statistical methodology allows for the evaluation of multiple factors simultaneously, including:

  • Induction temperature (typically lower temperatures of 16-25°C improve soluble expression)

  • IPTG concentration (often lower concentrations of 0.1-0.5 mM)

  • Expression time (shorter induction times of 4-6 hours may be optimal)

  • Media composition (enriched vs. minimal)

  • Cell density at induction (OD600 values between 0.6-1.0)

The fractional factorial design approach can efficiently identify optimal conditions while minimizing the number of experiments required . This methodology has successfully produced high yields (250 mg/L) of soluble recombinant protein in similar studies .

How can researchers validate the structural integrity of recombinant CP47 models?

Structural validation of recombinant CP47 requires a multi-faceted approach to ensure proper folding and configuration. Researchers should employ several complementary techniques:

First, computational validation using Ramachandran plot analysis through PROCHECK is essential for evaluating the quality of predicted or experimentally determined structures. For a well-modeled CP47 protein, approximately 90-95% of residues should fall within the core (most favorable) regions, and less than 1% should appear in disallowed regions . The table below illustrates typical quality parameters for a properly modeled CP47 structure:

Additionally, experimental validation should employ circular dichroism (CD) spectroscopy to confirm secondary structure elements, fluorescence spectroscopy to verify chlorophyll binding, and size exclusion chromatography to assess oligomeric state. Functional validation through chlorophyll fluorescence measurements can confirm proper energy transfer capabilities .

Energy minimization using software like CHIMERA with initial steepest descent followed by conjugated gradient algorithms can significantly improve model quality before validation .

What techniques are most effective for studying CP47-protein interactions within the PSII complex?

Several complementary approaches provide robust data on CP47 interactions within the PSII complex:

Co-immunoprecipitation (Co-IP) represents the foundation for identifying protein-protein interactions involving CP47. This technique uses antibodies specific to CP47 to pull down the protein along with its binding partners, which can then be identified through mass spectrometry. For transient or weak interactions, chemical crosslinking prior to Co-IP can stabilize these associations.

For detailed structural analysis of interactions, X-ray crystallography of the entire PSII complex remains the gold standard, though cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative that doesn't require crystallization. The resulting structural data can be analyzed using molecular modeling software to characterize interaction interfaces .

Mutational analysis provides functional insights into specific interaction domains. For example, the CP47-F363R mutation significantly alters the interaction between CP47 and PsbO, demonstrating the importance of this residue for proper complex assembly . Following mutagenesis, researchers should employ binding assays and functional studies to assess the impact on complex stability and function.

Computational approaches, including molecular dynamics simulations and protein-protein docking, can predict interaction interfaces and guide experimental design. These in silico methods are particularly valuable for generating hypotheses about interaction mechanisms that can subsequently be tested experimentally .

How does proton motive force affect CP47 function and contribute to photoinhibition?

Proton motive force (pmf) significantly impacts CP47 function within PSII through complex biophysical mechanisms that can ultimately lead to photoinhibition under certain conditions. The pmf consists of two components: the proton gradient (ΔpH) and the electrical potential (Δψ) across the thylakoid membrane.

Research indicates that high Δψ can induce photodamage to PSII (which includes CP47) even under moderate light conditions. When Δψ is elevated, it alters the energetics of charge recombination within PSII, potentially increasing the formation of chlorophyll triplet states that can generate singlet oxygen (¹O₂), a potent reactive oxygen species that damages PSII proteins including CP47 .

Experimental data demonstrates a statistical correlation between PSII inhibition (qI) and the redox state of the primary quinone acceptor (QA), though this relationship is modulated by both light intensity and non-photochemical quenching (qE). At any given light intensity, the QA redox state remains relatively stable while photoinhibition varies significantly depending on pmf conditions, suggesting that pmf-induced effects on PSII recombination rates play a crucial role in photodamage .

Under fluctuating light conditions, which are common in natural environments, transient "spikes" in Δψ occur upon each increase in light intensity. These spikes can reach amplitudes of 150-260 mV, sufficient to induce ¹O₂ generation and subsequent photodamage to PSII components including CP47 . This mechanism represents an important energetic limitation of photosynthesis that researchers investigating CP47 function must consider in their experimental designs.

What are the optimal experimental design approaches for expressing soluble recombinant photosynthetic proteins like CP47?

For successful expression of challenging membrane proteins like CP47, a systematic multivariant experimental design approach is strongly recommended over traditional univariant methods. The multivariant approach allows researchers to evaluate multiple factors simultaneously, account for interactions between variables, characterize experimental error, and gather high-quality information with minimal experiments .

A fractional factorial screening design (2^8-4 with center point replicates) provides an efficient framework to investigate eight key variables affecting recombinant protein expression:

  • Induction temperature (15-37°C)

  • IPTG concentration (0.1-1.0 mM)

  • Media composition (LB, TB, 2YT)

  • Cell density at induction (OD600 0.4-1.0)

  • Post-induction time (4-6 hours)

  • Agitation rate (200-400 rpm)

  • Supplemental chlorophyll precursors (ALA concentration)

  • Presence of chaperone co-expression

For CP47-like proteins, previous studies indicate that shorter induction times (4 hours) often provide the highest productivity while minimizing operational time . The expression conditions must balance cell growth with proper protein folding, as high cell growth does not necessarily correlate with high functional protein yields for complex membrane proteins.

To properly evaluate expression outcomes, three response variables should be measured:

  • Total protein yield (mg/L)

  • Soluble fraction percentage

  • Functional activity (measured through chlorophyll binding or spectroscopic properties)

This experimental design methodology has successfully achieved yields of 250 mg/L with 75% homogeneity for challenging recombinant proteins in E. coli .

What structural features of CP47 are critical for its function in energy transfer within PSII?

The CP47 protein contains several critical structural features that enable its function in energy transfer within PSII. Understanding these features is essential for researchers studying recombinant CP47:

The protein possesses multiple transmembrane helices that anchor it within the thylakoid membrane. These helices create a scaffold for precise positioning of chlorophyll molecules, which is crucial for efficient energy transfer. The protein's transmembrane organization also facilitates interactions with other PSII components, including the reaction center proteins D1 and D2 .

Chlorophyll binding sites represent perhaps the most critical functional element of CP47. These sites consist of specific amino acid residues (often histidine, glutamine, or asparagine) that coordinate magnesium atoms at the center of chlorophyll molecules. The precise arrangement of these binding sites creates an energy transfer pathway that funnels excitation energy toward the reaction center with minimal loss .

Loop regions connecting the transmembrane helices contribute to the protein's three-dimensional structure and often contain residues involved in interactions with other PSII components. These regions must maintain specific conformations to enable proper complex assembly and function .

How can researchers address challenges in structural characterization of recombinant CP47?

Structural characterization of recombinant CP47 presents several challenges that researchers can address through specialized approaches:

For membrane protein crystallization, lipidic cubic phase (LCP) or bicelle crystallization methods often yield better results than traditional vapor diffusion approaches. These techniques better mimic the native membrane environment, improving protein stability and crystal formation. Detergent screening is critical, with mild detergents like DDM, LMNG, or GDN typically performing better for membrane proteins like CP47 .

Cryo-electron microscopy (cryo-EM) offers a powerful alternative that doesn't require crystallization. For CP47, embedding the protein in nanodiscs can maintain native-like lipid environments during cryo-EM analysis. Recent advances in direct electron detectors and image processing algorithms have enabled near-atomic resolution of membrane protein structures using this approach .

Computational modeling combined with experimental constraints provides complementary structural information. Homology modeling using templates from related species (with sequence identity >50%) can generate initial models that can be refined using molecular dynamics simulations. Structure validation using Ramachandran plot analysis through PROCHECK should confirm that >90% of residues fall within favored regions, with G-factors above -0.5 .

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable information about protein dynamics and solvent-exposed regions, which is particularly useful for identifying functional domains and interaction interfaces. This technique is less dependent on obtaining crystals and can complement other structural approaches .

What are the most promising future research directions for recombinant CP47 studies?

Future research on recombinant Hordeum vulgare CP47 should focus on several promising directions that could significantly advance our understanding of photosynthesis and enable biotechnological applications.

Integrating structural biology with functional studies represents a particularly promising approach. By combining high-resolution structural information from techniques like cryo-EM with functional assays that measure energy transfer efficiency, researchers can establish structure-function relationships that explain how specific structural elements contribute to CP47's role in photosynthesis .

Engineering CP47 variants with enhanced stability or modified spectral properties could lead to improved photosynthetic efficiency or expanded light-harvesting capabilities. This approach requires a deep understanding of the relationship between protein structure and chlorophyll binding/orientation, guided by the structural analysis techniques described earlier .

Investigating CP47's role in photoprotection mechanisms is increasingly important given our understanding of how proton motive force affects photodamage. Research examining how CP47 structure and interactions influence PSII susceptibility to photoinhibition, particularly under fluctuating light conditions, could reveal new strategies for improving plant productivity under variable environmental conditions .

Developing improved expression and purification protocols specifically optimized for CP47 would benefit the entire research field. The application of multivariate experimental design approaches has shown promising results for other complex proteins and could significantly enhance recombinant CP47 yields and quality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.