Recombinant Hordeum vulgare Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant psbD is synthesized using advanced plastid transformation systems. Key methodologies include:

  • Expression systems: Chloroplast-specific vectors with psbD 5′-untranslated regions (UTRs) to enhance translational efficiency .

  • Tags: Epitope tags (determined during production) facilitate purification and detection .

  • Yield optimization: PsbD 5′-UTRs outperform other UTRs (e.g., atpA, psbA) in maximizing protein accumulation .

Table 1: Key Production Parameters

ParameterDetail
Host speciesHordeum vulgare (barley)
Expression region1–353 amino acids (full-length)
Storage bufferTris-based buffer with 50% glycerol
StabilityStable at -20°C; avoid repeated freeze-thaw cycles
ApplicationsELISA, PSII assembly studies, protein interaction assays

Role in PSII Assembly

  • The D2 protein initiates PSII assembly by serving as a scaffold for other subunits (e.g., D1, CP43) .

  • Recombinant psbD retains the ability to integrate into PSII complexes, enabling studies on repair mechanisms under photoinhibitory conditions .

Light-Regulated Turnover

  • Similar to native D2, the recombinant protein undergoes light-dependent degradation (half-life ~9.5–10 hours) .

  • Blue/UV-A light activates transcription via the psbD light-responsive promoter (LRP), a feature leveraged in expression systems .

Applications in Biotechnology

  • ELISA development: Used as an antigen for antibody production (e.g., Agrisera’s Anti-PsbD antibody) .

  • Therapeutic protein platforms: Plastid transformation with psbD UTRs enhances yields of recombinant therapeutics .

  • Photosynthesis research: Enables mutagenesis studies to dissect PSII repair pathways .

Table 2: Comparative Analysis of UTR-Driven Expression

5′-UTRExpression LevelKey AdvantageReference
psbDHighOptimal translation efficiency
atpAHighCompatible with multiple host systems
psbAModerateLight-inducible regulation

Key Studies

  • Promoter analysis: The barley psbD-LRP retains blue-light responsiveness in transgenic tobacco, confirming conserved regulatory elements (e.g., AAG-box) .

  • Degradation dynamics: Recombinant D2 degradation parallels D1 turnover under high-light stress, validating its use in photoinhibition models .

Future Directions

  • Structural studies: Cryo-EM analysis of recombinant psbD to resolve PSII repair intermediates.

  • Bioreactor scaling: Optimizing chloroplast transformation for industrial-scale production .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
psbD
Target Protein Sequence
MTIALGRVPKEENDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that subsequently drives ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of D2 protein (psbD) in the photosystem II complex?

The D2 protein encoded by the psbD gene is a chlorophyll-binding protein located in the photosystem II (PSII) reaction center. It functions as one of the core components of PSII, which is responsible for water splitting, oxygen evolution, and plastoquinone reduction in the photosynthetic electron transport chain . D2 works in conjunction with other proteins to form the structural and functional core of PSII, enabling the initial photochemical reactions of photosynthesis. Within the PSII complex, D2 is incorporated during the early stages of assembly, forming part of the minimal reaction center (RC) complex . Understanding D2's function provides fundamental insights into photosynthetic efficiency and plant adaptation to varying light conditions.

How is the psbD gene organized in the chloroplast genome of barley?

The psbD gene in barley (Hordeum vulgare) is located in the chloroplast genome and forms part of the psbD-psbC operon. This operon includes sequences for both the D2 protein (psbD) and the CP43 protein (psbC), which are essential components of photosystem II . The genomic organization includes several key features: multiple promoters that regulate transcription, specifically at least three distinct promoters for psbD with one being regulated by blue light . The psbD gene is positioned near other transfer RNA genes, including the divergent trnS and convergent trnG genes, which are located downstream of psbC . This genomic arrangement facilitates coordinated expression of photosynthetic proteins and reflects the evolutionary optimization of chloroplast gene organization.

What are the primary transcriptional start sites associated with psbD in barley?

Transcriptional analysis of barley psbD reveals multiple RNA species with distinct 5' and 3' termini, indicating complex transcriptional regulation. Research has identified four classes of RNAs containing psbD sequences that accumulate in plastids of dark-grown plants, with each class sharing a common 5'-terminus . These transcripts are designated as RNA groups 1a-1d, 2a and 2b, 3a and 3b, and 5a and 5b . For each of these four different 5'-ends, there are two corresponding clusters of 3'-ends that map near the divergent trnS and convergent trnG genes downstream of psbC . Additionally, the 3'-ends of RNAs 1c and 1d lie just upstream of the 5'-end of RNAs 2a and 2b, indicating potential RNA processing events or alternative transcription termination sites .

How does blue light regulate psbD transcription in barley?

Blue light regulation of psbD transcription occurs through a specific promoter known as the psbD blue-light-regulated promoter (BLRP) . This regulatory mechanism involves multiple DNA-binding complexes that interact with specific elements of the promoter. The BLRP consists of a -10 promoter element and an activating complex called AGF that binds immediately upstream of -35 . A second sequence-specific DNA-binding complex, PGTF, binds upstream of AGF between -71 and -100 in the barley psbD BLRP . Upon illumination of dark-grown barley seedlings, there is a shift in the pattern of transcripts produced, indicating that light induces changes in promoter utilization . This light-responsive mechanism allows plants to adjust photosynthetic capacity in response to changing light conditions, optimizing energy capture while minimizing photodamage.

What is the role of ADP-dependent phosphorylation in regulating psbD transcription?

ADP-dependent phosphorylation serves as a critical regulatory mechanism for psbD transcription through its effect on protein-DNA interactions. Research demonstrates that ADP-dependent phosphorylation selectively inhibits the binding of the PGTF complex to the barley psbD BLRP . Experimental evidence shows that ADP inhibits PGTF binding at relatively low concentrations (0.1 mM), whereas other nucleotides are unable to mediate this response . The physiological significance of this mechanism appears to involve light-dark transitions: phosphorylation of the regulatory protein increases in darkness in parallel with an increase in ADP concentration in chloroplasts, while dephosphorylation occurs upon plant illumination . This regulatory mechanism enables plants to modulate transcription in response to metabolic state, particularly the ADP/ATP ratio that reflects cellular energy status. Deletion studies of the PGT-box in transgenic tobacco demonstrated that this regulatory element reduced transcription from the psbD BLRP 5-fold, confirming its importance in promoter activity .

How does light induce a switch in psbD-psbC promoter utilization?

Light induces a significant switch in the utilization of psbD-psbC promoters, representing a novel transcriptional regulatory mechanism for this chloroplast operon . In dark-grown barley seedlings, specific RNAs containing psbD sequences accumulate in plastids, with four distinct classes of RNAs that share common 5'-termini . When 4.5-day-old dark-grown seedlings are illuminated, two additional types of psbD-psbC transcripts rapidly accumulate, labeled as RNAs 4a and 4b . This pattern indicates a light-induced switch in promoter utilization that results in changes to transcript abundance and processing. The mechanism involves light-activated transcription factors and regulatory complexes that preferentially bind to light-responsive elements in the promoter region. This promoter switching enables coordinated expression of photosynthetic genes in response to light, ensuring efficient assembly of functional photosystems during chloroplast development.

What methods are effective for studying psbD transcriptional regulation in vitro?

Several effective methods have been developed for studying psbD transcriptional regulation in vitro:

  • Gel-shift assays: These are crucial for identifying DNA-binding proteins that interact with regulatory elements of the psbD promoter. For example, gel-retardation assays using LRP136 as a DNA probe can detect complexes like PGTF (complex A) and their binding affinities under different nucleotide conditions .

  • ATP/ADP effect studies: Preincubation of plastid extracts with different nucleotides (ATP, UTP, GTP, CTP, ADP) followed by gel-shift assays can reveal nucleotide-dependent regulation of protein-DNA interactions .

  • Phosphocreatine/phosphocreatine kinase experiments: Adding these components to scavenge ADP can help determine if the observed effects are due to ATP itself or its breakdown product ADP .

  • Plastid 'run-on' transcription assays: This technique allows quantitation of transcription from specific genes like psbD-psbC by hybridization of radiolabeled plastid 'run-on' transcripts to filter-immobilized RNAs .

  • 5'-end mapping: Using primer extension or 5' RACE techniques to accurately map the transcription start sites and identify promoter regions of the psbD gene.

These methods, when combined, provide a comprehensive understanding of the complex transcriptional regulation of psbD, particularly with respect to light-dependent and ADP-dependent regulatory mechanisms.

What approaches are recommended for producing recombinant D2 protein for structural studies?

For producing recombinant D2 protein for structural studies, researchers should consider the following methodological approach:

  • Gene synthesis and optimization: Design a codon-optimized psbD gene sequence for the expression system of choice, typically E. coli for initial studies.

  • Expression system selection: Given the membrane-associated nature of D2 protein, specialized expression systems such as E. coli strains designed for membrane protein expression (C41/C43) may provide better yields.

  • Fusion protein strategies: Incorporate solubility-enhancing tags (MBP, SUMO, etc.) and purification tags (His, GST, etc.) to facilitate isolation of properly folded protein.

  • Detergent screening: Identify optimal detergents for extraction and stabilization of the recombinant D2 protein, preserving native structural properties.

  • Protein refolding protocols: Develop refolding strategies if expression results in inclusion bodies, gradually removing denaturants while introducing lipids or detergents.

  • Functional validation: Verify structural integrity through pigment binding assays, as D2 is a chlorophyll-binding protein.

  • Crystallization or cryo-EM preparation: Optimize buffer conditions and protein concentration for structural determination methods.

This experimental roadmap addresses the significant challenges associated with membrane protein production and provides a methodological framework for obtaining structurally intact recombinant D2 protein suitable for detailed biochemical and structural investigations.

How can researchers track PSII assembly incorporating D2 protein in vivo?

Tracking PSII assembly incorporating D2 protein in vivo requires specialized techniques that allow visualization of protein complex formation and dynamics. Recommended methodological approaches include:

  • Radioactive pulse-chase experiments: Label newly synthesized proteins with radioactive amino acids and track their incorporation into assembling complexes over time .

  • Two-dimensional blue native/SDS-PAGE analysis: This powerful technique separates intact protein complexes in the first dimension and their component proteins in the second dimension, allowing visualization of assembly intermediates .

  • Mass spectrometry-based proteomics: Apply quantitative proteomics to identify the composition of assembly intermediates and track changes in protein abundance during complex formation .

  • Fluorescent protein tagging: Generate transgenic plants expressing D2-fluorescent protein fusions to visualize localization and assembly dynamics using confocal microscopy.

  • Immunoprecipitation with stage-specific antibodies: Use antibodies that recognize specific assembly intermediates to isolate and characterize complexes at different stages of assembly.

The PSII assembly process in higher plants follows a sequential pathway: (1) assembly of precursor D1-PsbI and D2-cytochrome b559 precomplexes, (2) formation of the minimal reaction center, (3) incorporation of CP47 to form RC47a, (4) addition of low molecular mass subunits to form RC47b, (5) integration of CP43 to form OEC-less PSII monomer, (6) assembly of the oxygen-evolving complex, and (7) dimerization and formation of PSII-LHCII supercomplexes .

How do mutations in the psbD PGT-box affect light-responsive transcription?

The PGT-box functions may include:

  • Blocking read-through transcription from upstream psbD promoters active in dark-grown plants

  • Decreasing transcription from trnS, located immediately upstream of the psbD BLRP and read from the opposite DNA strand

  • Functioning as an enhancer element under specific light conditions

Researchers investigating PGT-box mutations should consider these multiple potential roles and design experiments that can distinguish between them. Targeted mutagenesis approaches that alter specific nucleotides rather than complete deletions may provide more nuanced understanding of how sequence variations affect regulatory protein binding and subsequent transcriptional outcomes.

What is the relationship between ADP/ATP ratio and psbD expression during light-dark transitions?

The relationship between ADP/ATP ratio and psbD expression during light-dark transitions represents a sophisticated regulatory mechanism linking energy metabolism to photosynthetic gene expression. Research indicates that ADP concentrations increase in chloroplasts during darkness, while illumination leads to ATP production and decreased ADP levels . This fluctuation in the ADP/ATP ratio appears to modulate psbD transcription through the following mechanism:

  • In darkness, increased ADP levels promote phosphorylation of regulatory factors like PGTF

  • Phosphorylated PGTF exhibits reduced binding to the PGT-box in the psbD BLRP

  • Reduced binding leads to decreased transcription from the blue-light responsive promoter

  • Upon illumination, decreased ADP levels and increased ATP production reverse this process

This regulatory circuit is analogous to other ADP-dependent phosphorylation systems in chloroplasts, such as the regulation of pyruvate orthophosphate dikinase (PPDK), which is inactivated by phosphorylation in darkness when ADP concentrations increase . Similar mechanisms have been observed for the regulation of psbA RNA-binding protein, where dark-induced, ADP-dependent phosphorylation contributes to decreased translation of the D1 protein .

The physiological significance of this regulatory mechanism is that it allows coordination of photosynthetic gene expression with the energy status of the chloroplast, preventing wasteful transcription and translation of photosynthetic proteins under conditions where they cannot function effectively.

How does the assembly and stability of D2 protein compare between cyanobacteria and higher plants?

The assembly and stability of D2 protein show both conservation and divergence between cyanobacteria and higher plants, reflecting evolutionary adaptations while maintaining core photosynthetic functions:

FeatureCyanobacteriaHigher PlantsEvolutionary Significance
Assembly PathwaySequential process with similar core stepsSimilar core steps but additional plant-specific factorsCore PSII structure conserved across photosynthetic organisms
Spatial OrganizationSpecialized membrane regions for assemblyDistinct spatial separation in thylakoid subdomainsIncreased compartmentalization in eukaryotic systems
Assembly FactorsSimpler set of assembly factorsAdditional plant-specific assembly factorsIncreased complexity in eukaryotic systems
Light RegulationLess complex light-responsive regulationMultiple light-responsive elements and factorsEnhanced light responsiveness in land plants
Repair MechanismsEfficient PSII repair cycleMore complex repair mechanisms with additional regulatory layersAdaptation to fluctuating terrestrial environments

Higher plants have evolved additional regulatory mechanisms for controlling D2 expression and incorporation into PSII, such as the blue-light responsive promoter system that is not present in cyanobacteria. This increased regulatory complexity likely reflects adaptations to the more variable light environments encountered by land plants compared to aquatic cyanobacteria.

How should researchers interpret conflicting data on psbD regulation across different plant species?

When encountering conflicting data on psbD regulation across different plant species, researchers should employ a systematic analytical approach:

  • Evolutionary context assessment: Consider the evolutionary relationships between studied species and how regulatory mechanisms may have diverged. While core photosynthetic functions are conserved, regulatory elements may evolve more rapidly to adapt to specific ecological niches.

  • Experimental condition standardization: Evaluate whether differences in experimental conditions (light quality, intensity, duration, plant age, tissue type) may explain apparent contradictions. For example, deletion of the PGT-box in tobacco had different effects depending on whether plants were grown in cycling light conditions versus continuous light after dark adaptation .

  • Methodological variation analysis: Consider how different experimental approaches might yield apparently conflicting results. Direct comparisons between in vitro binding studies, in vivo reporter assays, and transcript quantification may be complicated by methodological differences.

  • Regulatory network complexity consideration: Recognize that psbD regulation involves multiple interacting factors. Species-specific differences in one component may be compensated by adjustments in other parts of the regulatory network.

  • Data integration strategies: Develop models that can accommodate species-specific variations while identifying conserved core regulatory mechanisms. Meta-analysis approaches that systematically compare results across species can be particularly valuable.

When applied to psbD research, this approach has revealed that while specific promoter elements and binding factors may vary between species, the fundamental regulatory principles—such as light responsiveness and energy status sensing through ADP/ATP ratios—appear conserved across diverse plant lineages.

What statistical approaches are best for analyzing dynamic changes in psbD transcript levels?

For analyzing dynamic changes in psbD transcript levels, researchers should implement sophisticated statistical approaches that account for the temporal nature and multiple regulatory influences on gene expression:

  • Time series analysis: Apply methods specifically designed for temporal data, such as autoregressive models or dynamic Bayesian networks, to capture the sequential nature of transcript level changes during light transitions.

  • Mixed-effects models: Utilize these models to account for both fixed effects (e.g., light conditions, temperature) and random effects (e.g., biological variation between plant samples) on psbD transcript levels.

  • Functional data analysis: Treat expression profiles as continuous functions rather than discrete measurements, allowing for more nuanced analysis of expression dynamics.

  • Change-point detection algorithms: Employ these to identify precise moments when transcript levels significantly shift, particularly useful when analyzing the timing of light-induced promoter switching.

  • Multivariate analysis techniques: Use methods such as principal component analysis or partial least squares regression to understand how multiple factors simultaneously influence psbD expression.

  • Permutation tests: Apply these non-parametric approaches when traditional statistical assumptions may not be met, providing robust significance assessment for complex experimental designs.

When designing experiments to measure psbD transcript dynamics, researchers should include sufficient biological replicates, appropriate time resolution to capture rapid changes during light transitions, and proper controls for factors known to influence chloroplast gene expression, such as plant developmental stage and circadian effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.