Recombinant Hordeum vulgare Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Hordeum vulgare Photosystem Q(B) protein, also known as Photosystem II protein D1 (PsbA), is a chloroplast-encoded thylakoid membrane protein critical for photosynthesis. It serves as the reaction center of Photosystem II (PSII), facilitating water oxidation and plastoquinone reduction. Recombinant production enables detailed biochemical and biophysical studies of its role in electron transport and stress responses .

Primary Sequence

  • Gene: psbA (UniProt: P05337) .

  • Amino Acid Sequence: Comprises residues 2–344, including key domains for chlorophyll binding, manganese stabilization, and plastoquinone interaction .

  • Post-Translational Modifications: N-terminal processing removes the transit peptide .

Molecular Architecture

  • Molecular Weight: ~32 kDa .

  • Membrane Topology: Five transmembrane helices with lumenal/extrinsic domains for cofactor binding .

Expression Systems

  • Hosts: Optimized in E. coli for high-yield insoluble inclusion bodies, with refolding in vitro to restore functionality .

  • Yield: ≥85% purity confirmed by SDS-PAGE .

Photosystem II Assembly

  • Electron Transport: Binds plastoquinone (Q<sub>B</sub>), mediating electron transfer from pheophytin to the PQ pool .

  • Water Oxidation: Stabilizes the Mn<sub>4</sub>CaO<sub>5</sub> cluster essential for O<sub>2</sub> evolution .

Mechanistic Studies

  • Photoinhibition Models: Used to study D1 protein turnover under high-light stress .

  • Mutagenesis: Site-directed mutants (e.g., His-tagged variants) elucidate residues critical for Q<sub>B</sub> binding .

Biotechnological Relevance

  • Crop Engineering: Overexpression studies aim to enhance PSII repair efficiency under abiotic stress .

Table 2: Functional Conservation Across Species

SpeciesProteinRole in PSIIReference
Hordeum vulgarePsbA (D1)Q<sub>B</sub> binding, CET
Arabidopsis thalianaPsbP/PPL1PSII repair, NDH complex
Physcomitrella patensLHCb9Antenna protein modulation

Challenges and Future Directions

  • Stability Issues: Recombinant D1 requires detergents (e.g., Triton X-100) for solubilization, complicating structural studies .

  • Functional Reconstitution: In vitro refolded protein shows reduced activity compared to native complexes .

Future research should prioritize cryo-EM refinements and in planta functional assays to validate recombinant D1’s role in stress adaptation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences you may have. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs as default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
We will select the tag type during production. If you have a specific tag preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Hordeum vulgare (Barley)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O. This process generates O(2) and a proton gradient, which is subsequently utilized for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts light excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its role in photosynthesis?

Photosystem Q(B) protein, also known as D1 protein (EC 1.10.3.9), is a critical 32 kDa thylakoid membrane protein encoded by the chloroplast gene psbA. This protein serves as a core component of Photosystem II (PSII), functioning as part of the water-plastoquinone oxidoreductase mechanism that is essential for initiating photosynthetic electron transport .

How is D1 protein structurally characterized?

The barley D1 protein (Uniprot: P05337) consists of 344 amino acids with a highly conserved sequence across plant species. The full amino acid sequence includes multiple transmembrane domains that anchor the protein within the thylakoid membrane .

To characterize D1 protein structure, researchers typically employ techniques such as:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by second-dimension SDS-PAGE to analyze complex formation

  • Immunoblotting with D1-specific antibodies to detect the protein in various fractions

  • Mass spectrometry for detailed structural analysis and post-translational modifications

When analyzing D1 integration into PSII complexes, it's critical to maintain sample integrity by using appropriate buffer conditions and avoiding repeated freeze-thaw cycles that may disrupt membrane protein structure .

What are the standard methods for working with recombinant D1 protein?

When working with recombinant Hordeum vulgare Photosystem Q(B) protein, researchers should consider the following methodological approaches:

  • Storage considerations: Store the protein at -20°C for regular use, or at -80°C for extended storage. Avoid repeated freeze-thaw cycles by working with small aliquots .

  • Buffer compatibility: The protein is typically stored in Tris-based buffer with 50% glycerol. For functional studies, ensure buffer compatibility with planned assays .

  • RNA immunoprecipitation (RIP) assays: When studying interactions with regulatory factors, RIP assays can be employed to investigate protein-RNA interactions, particularly with the psbA mRNA that encodes D1 .

  • Translation efficiency analysis: Polysome analysis can be conducted to determine ribosome loading on psbA mRNA, which directly reflects D1 translation efficiency .

How does light regulate D1 protein synthesis and what are the molecular mechanisms involved?

The regulation of D1 protein synthesis is intricately linked to light conditions through complex molecular mechanisms. Research has demonstrated that light regulates D1 protein translation primarily through interactions with the 5' UTR of psbA mRNA .

Methodologically, researchers can investigate this regulatory process through several approaches:

  • Light-dependent association studies: RNA immunoprecipitation (RIP) assays under varying light conditions have revealed that regulatory proteins like LPE1 (a pentatricopeptide repeat protein) associate with the 5' UTR of psbA mRNA in a light-dependent manner .

  • Redox regulation analysis: Experimental evidence indicates that redox state affects the association between regulatory proteins and psbA mRNA. The use of reducing agents like DTT in experimental setups can help determine whether protein-RNA interactions are redox-dependent .

  • AMS labeling assays: These assays have demonstrated that light regulates the redox state of proteins like LPE1, suggesting that light modulates RNA-binding activity through redox modification of conserved cysteine residues .

Researchers have found that D1 translation may be regulated by light at multiple levels, including:

  • Control of association between psbA mRNA and activator proteins (mediated by factors like LPE1)

  • Modulation of transcription of regulatory factors (such as HCF173)

  • Redox-dependent binding of trans-factors to the psbA 5' UTR

These findings indicate that higher plants share conserved mechanisms with primitive photosynthetic organisms for regulating D1 synthesis, though they employ distinct regulatory factors evolved for their specific needs .

What is known about the relationship between mitochondrial activity and D1 protein function?

The interplay between mitochondrial activity and photosynthetic function, particularly D1 protein performance, represents an important area of photosynthetic research. Studies using oligomycin (a specific inhibitor of oxidative phosphorylation) on barley leaf protoplasts have revealed complex relationships between mitochondrial activity and photosynthetic performance under varying light conditions .

Methodological approach for investigating this relationship:

  • Inhibitor-based studies: Adding oligomycin at concentrations that specifically inhibit oxidative phosphorylation while monitoring photosynthetic oxygen evolution under different light intensities and CO₂ concentrations.

  • Fluorescence quenching measurements: This technique provides real-time information about photosynthetic efficiency under various conditions.

  • Metabolite analysis: Measuring ATP/ADP ratios in different cellular compartments (mitochondrial, cytosolic, and chloroplastic) to track energy distribution.

Research findings indicate that mitochondrial contribution to photosynthetic metabolism varies significantly depending on light conditions:

Light ConditionEffect of Mitochondrial InhibitionProposed Mechanism
Saturating LightDecreased photosynthetic oxygen evolutionInhibition of sucrose synthesis creates feedback inhibition on the Calvin cycle
Low LightDecreased photosynthetic oxygen evolutionReduced ATP supply to cytosol limits biosynthetic reactions
Intermediate LightLittle to no effectAlternative pathways compensate for mitochondrial inhibition

These findings suggest that at high light intensities, mitochondria serve to oxidize excess photosynthetic redox equivalents, while at low light, they primarily supply ATP to support biosynthetic reactions .

What factors influence D1 protein turnover and PSII repair under stress conditions?

D1 protein exhibits remarkably high turnover rates, particularly under stress conditions, making the efficiency of D1 synthesis crucial for PSII repair and plant stress tolerance. Several factors have been identified that influence this process:

  • Light stress effects: High light exposure accelerates D1 degradation, requiring increased synthesis rates to maintain PSII function. Experimental studies show that mutants with impaired D1 synthesis display more severe photoinhibition (qI) under high light stress .

  • Regulatory protein interactions: The interaction between regulatory factors like LPE1 and HCF173 is critical for efficient D1 synthesis. Co-immunoprecipitation and BN-PAGE analysis have demonstrated that these proteins form part of a higher molecular weight complex that regulates psbA mRNA translation .

  • Redox state influence: The redox environment directly affects the binding capability of regulatory proteins to the psbA mRNA, thereby modulating D1 synthesis rates. This has been demonstrated through in vitro binding assays under varying redox conditions .

Methodological approaches for studying D1 turnover include:

  • Pulse-chase experiments with radiolabeled amino acids to track protein synthesis and degradation rates

  • Western blot analysis to detect D1 degradation fragments

  • Chlorophyll fluorescence measurements to assess PSII functionality during repair

Research has shown that defects in D1 synthesis not only affect PSII assembly but can create cascading effects on other photosynthetic components. For instance, studies of lpe1 mutants revealed reduced synthesis of PsaA/B and CP47, likely as indirect consequences of D1 deficiency .

How do regulatory proteins like LPE1 and HCF173 coordinate D1 synthesis?

The coordinated action of regulatory proteins is essential for efficient D1 synthesis. Research has identified multiple proteins that form regulatory complexes to control this process:

Methodological approaches to investigate these interactions include:

  • Co-immunoprecipitation assays: These have demonstrated direct physical interaction between LPE1 and HCF173 proteins .

  • RIP analysis with RNase treatment: This technique has shown that the LPE1-HCF173 interaction is not dependent on psbA mRNA abundance, suggesting a direct protein-protein interaction .

  • Blue native PAGE followed by second-dimension SDS-PAGE: This approach has confirmed that LPE1 and HCF173 are part of the same supercomplex involved in regulating D1 synthesis .

The current model suggests that:

  • LPE1 directly binds to the 5' UTR of psbA mRNA in a light-dependent manner

  • This binding facilitates the association of HCF173 with psbA mRNA

  • Together, these proteins promote efficient loading of ribosomes onto psbA mRNA

  • The result is enhanced translation of D1 protein, especially under changing light conditions

Interestingly, while LPE1 homologs are found exclusively in land plants, HCF173 homologs exist in various photosynthetic organisms including algae, suggesting these regulatory mechanisms evolved at different times .

What considerations are important when designing experiments to study D1 protein function?

When designing experiments to investigate D1 protein function, researchers should consider several critical factors:

  • Light condition standardization: Given the light-dependent regulation of D1 synthesis, precise control of light intensity, duration, and quality is essential. Experiments should include:

    • Dark-to-light transition protocols for studying induction

    • Controlled light intensity gradients for dose-response analyses

    • Spectral quality control for wavelength-specific effects

  • Redox environment control: As D1 regulation involves redox-sensitive mechanisms, experiments should:

    • Include appropriate redox buffers

    • Consider using redox modifying agents (e.g., DTT) in controlled experiments

    • Monitor cellular redox status during experiments

  • Protein storage and handling: When using recombinant D1 protein:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • Use Tris-based buffer with 50% glycerol for optimal stability

  • Appropriate controls: When studying regulatory factors:

    • Include RNA-binding specificity controls (non-target RNA)

    • Test protein-protein interactions with and without target RNAs

    • Use wild-type comparisons alongside mutant analyses

A methodical approach involving these considerations will enhance experimental reproducibility and data reliability.

How can researchers differentiate between direct and indirect effects on D1 protein synthesis?

Distinguishing direct from indirect effects on D1 protein synthesis represents a significant challenge in photosynthesis research. Several methodological approaches can help address this challenge:

  • Temporal resolution studies: Monitoring the chronological sequence of events following experimental intervention can help identify primary versus secondary effects. Short time-course experiments are particularly valuable for capturing direct effects before compensatory responses occur .

  • Multiple assay integration: Combining techniques provides more robust evidence:

    • Direct RNA binding assays (RIP, gel shift assays)

    • Translational efficiency measurements (polysome profiling)

    • Protein synthesis rate determination (pulse labeling)

    • Protein accumulation analysis (immunoblotting)

  • Genetic complementation: In studies using mutants (e.g., lpe1), complementation with the wild-type gene should restore normal D1 synthesis if the effect is direct. Partial restoration may indicate additional factors at play .

  • Domain-specific mutations: Introducing specific mutations in functional domains of regulatory proteins can help pinpoint which interactions are essential for D1 synthesis regulation .

Research has shown that defects in one PSII subunit can delay the assembly of PSII complexes and disturb the synthesis of other subunits. This knowledge helps researchers interpret complex phenotypes where multiple photosynthetic components appear affected .

How can D1 protein research contribute to improving crop photosynthetic efficiency?

Research on D1 protein dynamics offers significant potential for enhancing crop productivity through improved photosynthetic efficiency. Several promising research directions include:

  • Stress tolerance enhancement: Understanding the molecular mechanisms of D1 turnover and PSII repair can inform strategies to improve crop performance under stress conditions. For example, plants with optimized D1 synthesis rates might show enhanced recovery from high light stress .

  • Light utilization optimization: Knowledge of how light regulates D1 synthesis through redox-dependent mechanisms could lead to crops with improved photosynthetic efficiency across variable light environments, particularly important for field conditions where light intensity fluctuates constantly .

  • Genetic engineering approaches: Potential targets include:

    • Optimizing regulatory elements in the psbA 5' UTR

    • Modifying expression levels of regulatory factors like LPE1 and HCF173

    • Engineering redox-insensitive variants of key regulatory proteins

Methodologically, researchers should approach this area through:

  • Comparative studies across crop varieties with different photosynthetic efficiencies

  • Field trials under fluctuating environmental conditions

  • Integration of D1 dynamics data with whole-plant photosynthetic performance metrics

What are the most promising techniques for studying D1 protein interactions in vivo?

Investigating D1 protein interactions in living systems presents unique challenges but offers valuable insights into photosynthetic regulation. The most promising techniques include:

  • In vivo RNA-protein interaction studies:

    • RNA immunoprecipitation sequencing (RIP-seq) allows genome-wide identification of RNA targets for D1 regulatory proteins

    • Crosslinking immunoprecipitation (CLIP) techniques provide higher resolution of binding sites

    • These approaches have successfully identified the 5' UTR of psbA mRNA as a direct target of regulatory proteins like LPE1

  • Protein complex identification:

    • Blue native PAGE followed by mass spectrometry has proven effective for identifying components of D1 synthesis/assembly complexes

    • Proximity-based labeling methods (BioID, APEX) can reveal transient interaction partners

    • These techniques have helped establish that regulatory factors like LPE1 and HCF173 form part of the same supercomplex

  • Real-time monitoring systems:

    • Fluorescence recovery after photobleaching (FRAP) to study D1 mobility in thylakoid membranes

    • Förster resonance energy transfer (FRET) systems to detect protein-protein interactions

    • These approaches provide dynamic information about D1 behavior during assembly and repair

When designing in vivo studies, researchers should consider species-specific differences in regulatory mechanisms. While the basic function of D1 is conserved, research has shown that higher plants and primitive photosynthetic organisms employ distinct regulatory factors to control D1 synthesis .

How does D1 protein regulation differ between barley and other photosynthetic organisms?

The regulation of D1 protein synthesis shows both conservation and divergence across photosynthetic organisms, reflecting evolutionary adaptations to different ecological niches:

  • Regulatory mechanism conservation:

    • Light regulation of D1 synthesis through the 5' UTR of psbA mRNA appears to be a conserved mechanism across photosynthetic organisms

    • Redox-dependent regulation of protein binding to the psbA mRNA is observed in both algae (like Chlamydomonas) and higher plants including barley

  • Regulatory factor divergence:

    • Higher plants like barley utilize specific factors such as LPE1, which are absent in algae

    • LPE1 homologs are found exclusively in land plants, suggesting their evolution coincided with adaptation to terrestrial environments

    • HCF173 homologs exist in various photosynthetic organisms but with low sequence similarity across distant lineages

  • Sequence differences:

    • The psbA mRNA 5' UTR sequences differ significantly between species like barley and Chlamydomonas

    • These differences necessitate different trans-regulatory factors despite serving similar functions

Methodologically, comparative genomic approaches combined with functional assays in diverse organisms have been instrumental in identifying these evolutionary patterns. The data suggest that while the fundamental mechanisms of light-regulated D1 synthesis are conserved, the specific molecular players have diversified during evolution from aquatic to terrestrial environments .

What roles do mitochondria play in photosynthetic metabolism across different plant species?

The contribution of mitochondria to photosynthetic metabolism represents an important aspect of cellular energy integration that may vary across plant species:

  • Energy balance regulation:

    • Studies in barley have shown that mitochondrial activity affects photosynthetic performance differently depending on light conditions

    • Under high light, mitochondria help oxidize excess photosynthetic redox equivalents

    • Under low light, they primarily supply ATP to support biosynthetic reactions

  • Cross-compartment signaling:

    • Mitochondrial inhibition with oligomycin reveals compartment-specific effects on ATP/ADP ratios

    • While mitochondrial and cytosolic ATP/ADP ratios decrease dramatically, the chloroplastic ratio shows little change

    • This suggests sophisticated regulatory mechanisms that maintain chloroplast energy status even when mitochondrial function is compromised

  • Metabolic feedback regulation:

    • The inhibition of mitochondrial function reduces sucrose phosphate synthase activity

    • Under high light, this inhibition of sucrose synthesis creates feedback inhibition on the Calvin cycle

    • This mechanism links mitochondrial activity, carbon fixation, and photosynthetic electron transport

Methodologically, comparative studies using specific inhibitors (like oligomycin) combined with measurements of photosynthetic parameters, fluorescence quenching, and metabolite analysis provide insights into these cross-compartment interactions. These approaches reveal how plants have evolved integrated cellular energy networks that optimize photosynthetic performance under varying environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.