Recombinant Hordeum vulgare Protein MLO (MLO)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Immunity

MLO functions as a negative regulator of plant defense:

  • Pathogen Susceptibility: Wild-type MLO dampens hydrogen peroxide production at fungal penetration sites, facilitating pathogen entry .

  • Cell Death Regulation: It suppresses mesophyll cell death triggered by fungal invasion, with mlo mutants exhibiting spontaneous cell death and accelerated senescence .

  • Broad-Spectrum Resistance: Recessive mlo alleles confer durable resistance to Blumeria graminis f. sp. hordei (barley powdery mildew) .

Genetic and Biochemical Insights

  • Mutations in the MLO locus (e.g., mlo-1, mlo-3) disrupt the protein’s membrane localization, leading to constitutive defense activation .

  • Structural studies reveal that MLO’s transmembrane domains mediate its interaction with plasma membrane lipids, while the cytoplasmic domain recruits signaling partners like calmodulin .

Disease Resistance Mechanisms

  • Oxidative Burst Modulation: MLO suppresses the biphasic oxidative burst (H₂O₂) in epidermal and mesophyll cells during fungal attack .

  • Transcriptional Regulation: MLO expression is upregulated during pathogen infection, suggesting feedback regulation of defense pathways .

Applications in Agriculture

  • Disease-Resistant Crops: mlo mutants are widely used in barley breeding programs to develop powdery mildew-resistant cultivars .

  • Biotechnological Tools: Recombinant MLO enables in vitro studies of protein-protein interactions and calcium signaling pathways .

Future Directions

  • Structural Biology: High-resolution NMR or cryo-EM studies could elucidate MLO’s conformational dynamics .

  • CRISPR Applications: Targeted editing of MLO orthologs in crops like wheat and tomato to engineer resistance .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
MLO; Protein MLO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
full length protein
Species
Hordeum vulgare (Barley)
Target Names
MLO
Target Protein Sequence
MSDKKGVPARELPETPSWAVAVVFAAMVLVSVLMEHGLHKLGHWFQHRHKKALWEALEKM KAELMLVGFISLLLIVTQDPIIAKICISEDAADVMWPCKRGTEGRKPSKYVDYCPEGKVA LMSTGSLHQLHVFIFVLAVFHVTYSVITIALSRLKMRTWKKWETETTSLEYQFANDPARF RFTHQTSFVKRHLGLSSTPGIRWVVAFFRQFFRSVTKVDYLTLRAGFINAHLSQNSKFDF HKYIKRSMEDDFKVVVGISLPLWGVAILTLFLDINGVGTLIWISFIPLVILLCVGTKLEM IIMEMALEIQDRASVIKGAPVVEPSNKFFWFHRPDWVLFFIHLTLFQNAFQMAHFVWTVA TPGLKKCYHTQIGLSIMKVVVGLALQFLCSYMTFPLYALVTQMGSNMKRSIFDEQTSKAL TNWRNTAKEKKKVRDTDMLMAQMIGDATPSRGSSPMPSRGSSPVHLLHKGMGRSDDPQSA PTSPRTQQEARDMYPVVVAHPVHRLNPNDRRRSASSSALEADIPSADFSFSQG
Uniprot No.

Target Background

Function
This protein appears to play a role in regulating pathogen defense and leaf cell death. It down-regulates broad-spectrum resistance to powdery mildew fungus, and its defense suppression activity is enhanced by Ca(2+)-dependent calmodulin binding. The signaling pathway involved does not seem to require heterotrimeric G proteins.
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Experimental Resources and Methodologies

  • What expression systems are optimal for producing recombinant MLO protein?

    Successful production of functional recombinant MLO presents significant challenges due to its multiple transmembrane domains. Several expression systems can be considered, each with distinct advantages:

    Expression SystemAdvantagesLimitationsOptimization Strategies
    E. coliHigh yield, economicalPoor for membrane proteinsUse specialized strains (C41/C43), fusion tags
    Yeast (P. pastoris)Eukaryotic processing, high densityGlycosylation differs from plantsCodon optimization, inducible promoters
    Insect cellsComplex protein productionHigher cost, technical complexityBaculovirus optimization, expression screening
    Plant-based systemsNative processing environmentLower yields typicallyTransient expression, viral vectors

    For membrane proteins like MLO, solubilization is a critical step. Researchers should test multiple detergents (DDM, LMNG, GDN) or nanodiscs for optimal extraction while maintaining protein stability. For functional studies, reconstitution into proteoliposomes can preserve native-like activity. When expression of full-length MLO proves challenging, domain-by-domain expression of soluble regions (like the C-terminal cytoplasmic domain) can yield valuable structural and functional insights, as demonstrated for other plant proteins .

  • What are the most effective methods for studying MLO localization and dynamics?

    Accurate visualization of MLO localization and dynamics requires advanced cell biological approaches. Fluorescent protein fusions (GFP, mCherry) to MLO can be used for live-cell imaging, but care must be taken to ensure tags don't interfere with topology or function. Super-resolution microscopy techniques such as STORM, PALM, or Structured Illumination Microscopy provide nanoscale resolution of MLO distribution within membrane microdomains. For studying protein dynamics, fluorescence recovery after photobleaching (FRAP) can measure MLO mobility within membranes, while photoactivatable fluorescent proteins allow pulse-chase imaging to track newly synthesized MLO. Ratiometric imaging with pH-sensitive fluorescent proteins can monitor MLO trafficking through compartments with different pH. Co-localization studies with markers for specific membrane compartments (endosomes, Golgi, ER) can track MLO movement during infection. For quantitative analysis, automated image analysis pipelines using software like ImageJ/Fiji with custom plugins allow extraction of parameters such as clustering coefficient, diffusion rates, and co-localization metrics.

  • What genetic resources and mutant collections are available for MLO research?

    A diverse array of genetic resources has been developed for MLO research across multiple plant species:

    Resource TypeExamplesApplicationsAvailability
    Natural variantsBarley mlo-11 from EthiopiaEvolutionary studiesGene banks, research collections
    Induced mutationsBarley mlo-1 to mlo-10Structure-function analysisBarley mutant collections
    T-DNA insertionsArabidopsis mlo mutantsReverse geneticsStock centers (ABRC, NASC)
    TILLING linesTomato SlMLO1 variantsAllelic seriesResearch laboratories
    CRISPR-edited linesVarious crop speciesEngineered resistanceDeveloping rapidly
    Transgenic linesComplementation lines, overexpressionFunctional validationResearch laboratories
    Near-isogenic linesMLO/mlo in common backgroundsClean genetic comparisonsBreeding programs

    When working with these resources, researchers should consider genetic background effects by using appropriate controls. For barley specifically, the extensive collection of natural and induced mlo alleles provides a valuable resource for understanding structure-function relationships . When developing new mutants, targeting conserved regions identified through multi-species alignment increases the likelihood of obtaining loss-of-function phenotypes.

  • How can high-throughput phenotyping accelerate MLO research?

    Modern phenotyping technologies can significantly enhance MLO research by enabling quantitative, non-destructive measurements at scale. Automated imaging systems using RGB, chlorophyll fluorescence, thermal, and hyperspectral cameras can detect subtle phenotypic differences between wild-type and mlo genotypes. Machine learning algorithms applied to these image data can identify distinctive features associated with mlo-mediated resistance or pleiotropic effects. Robotic systems for pathogen inoculation and disease scoring increase experimental throughput and reduce human bias. Metabolic phenotyping using techniques like NMR-based metabolomics can detect biochemical signatures associated with different MLO variants. Digital pathology approaches using automated microscopy and image analysis can quantify cellular-level responses such as hydrogen peroxide accumulation, callose deposition, and cell death across large sample sets. Field-based phenotyping using drones or sensor networks allows assessment of mlo effects under realistic growing conditions. These high-throughput approaches generate rich datasets that, when integrated with genomic and transcriptomic data, can reveal novel aspects of MLO function.

Emerging Research Directions

  • How does MLO function interconnect with broader cellular stress responses?

    MLO transcript abundance increases in response to diverse stresses including wounding, oxidative stress, and during leaf senescence , suggesting integration with fundamental cellular stress response networks. To investigate these connections, researchers can perform comparative transcriptomics and proteomics of wild-type versus mlo plants under multiple stress conditions to identify commonly and differentially regulated pathways. Metabolomic profiling can reveal how MLO affects the production of stress-associated metabolites such as reactive oxygen species, stress hormones, and defensive compounds. Genetic interaction studies creating double mutants between mlo and key stress response regulators can establish pathway relationships. Cell biological approaches can track MLO relocalization during different stress responses. Analyses of post-translational modifications on MLO protein following various stresses may reveal regulatory mechanisms. These investigations have practical implications for crop improvement, as they can identify potential trade-offs between disease resistance and adaptation to other environmental challenges when deploying mlo mutations in agriculture.

  • What role might MLO play in regulating plant-microbiome interactions?

    MLO's involvement in powdery mildew interactions raises questions about its potential role in broader plant-microbe associations. To explore this dimension, researchers can compare root and phyllosphere microbiome composition between wild-type and mlo plants using 16S/ITS amplicon sequencing or shotgun metagenomics. Gnotobiotic systems where plants are grown with defined synthetic microbial communities can reveal specific microbial taxa affected by MLO status. Metabolomic analysis of root exudates may identify compounds differentially produced in mlo plants that could influence microbial recruitment. Transcriptome analysis of plants and associated microbes can uncover communication pathways affected by MLO. Co-expression network analysis integrating plant and microbial gene expression data can identify potential cross-kingdom signaling networks involving MLO. These studies could reveal whether mlo mutations, while conferring disease resistance, might also alter beneficial microbial associations, with potential consequences for plant health and ecosystem functions.

  • How can systems biology approaches enhance our understanding of MLO's role in immune networks?

    MLO functions within complex immunity networks whose emergent properties are difficult to predict from individual components. Systems biology approaches can address this complexity. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and phenomics data from wild-type and mlo plants under various conditions can reveal network-level properties. Mathematical modeling of defense signaling networks incorporating MLO as a regulatory node can generate testable predictions about system behavior. Comparative network analysis across multiple plant species with characterized mlo mutations can identify conserved network motifs. Genome-scale metabolic modeling can predict how MLO-mediated changes affect energy allocation between growth and defense. Network perturbation experiments, where multiple nodes in defense networks are manipulated simultaneously, can reveal synergistic or antagonistic relationships with MLO. Time-resolved sampling and analysis following pathogen challenge can capture dynamic network reconfiguration and identify critical decision points where MLO exerts regulatory influence.

  • What potential exists for engineering novel MLO variants with enhanced or specialized functions?

    Beyond creating simple loss-of-function mutations, engineering MLO proteins with novel properties represents an exciting frontier. Using directed evolution approaches, researchers can generate libraries of MLO variants through random mutagenesis or DNA shuffling, followed by selection for desired traits such as broad-spectrum resistance without yield penalties. Rational design based on structural insights can create MLO proteins with modified domain architecture or altered interaction interfaces. CRISPR base editing or prime editing can introduce precise amino acid changes to test structure-function hypotheses or create variants with specific properties. Synthetic biology approaches might involve creating chimeric MLO proteins incorporating domains from other defense regulators to engineer novel signaling properties. Inducible or tissue-specific expression systems for engineered MLO variants can provide temporal and spatial control over resistance activation. Field testing of plants expressing engineered MLO variants under diverse environmental conditions is essential to assess agronomic performance and resistance durability. These approaches have the potential to create tailored MLO-based resistance strategies optimized for specific crops and growing environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.