Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Shipped with Ice Packs
In Stock

Description

Introduction

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (3β-HSD), is a crucial enzyme involved in steroid hormone synthesis . It catalyzes essential steps in the formation of active steroid hormones by converting Δ5-3β-hydroxysteroid precursors into Δ4-ketosteroids . This enzyme is essential for the production of various steroid hormones, including progestogens, glucocorticoids, mineralocorticoids, and androgens .

Function and Mechanism

3β-HSD is a bifunctional enzyme that performs two sequential reactions :

  1. Oxidation of the 3β-hydroxyl group of Δ5-ene steroids to a 3-keto group.

  2. Isomerization of the Δ5 double bond to the Δ4 position.

These reactions are critical for converting steroids like pregnenolone to progesterone, 17-hydroxypregnenolone to 17-hydroxyprogesterone, and dehydroepiandrosterone (DHEA) to androstenedione . These conversions are vital steps in the synthesis of downstream steroid hormones.

Isoenzymes and Genetic Regulation

In humans, two main isoenzymes of 3β-HSD exist, namely type I and type II . Type I is found in placenta and peripheral tissues, while type II is predominantly expressed in the adrenal gland, ovary, and testis . The HSD3B2 gene, encoding the type II isoenzyme, is regulated by orphan nuclear receptors such as steroidogenic factor-1 (SF-1) and dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome gene 1 (DAX-1) . Signal transduction pathways involving STAT5 and STAT6 may also play a role in the transcriptional activation of the HSD3B2 promoter .

Deficiency and Clinical Significance

Deficiency in 3β-HSD can lead to congenital adrenal hyperplasia (CAH), a condition resulting in impaired steroid hormone synthesis . A deficiency can manifest differently based on which isoenzyme is affected. For example, an inherited impairment of 3-HSD activity confined to C-21 steroid substrates suggests the existence of at least two 3-HSD isoenzymes under independent genetic regulation . Mutations in the HSD3B2 gene can result in a wide spectrum of molecular repercussions, which are associated with the different phenotypic manifestations of classical 3β-HSD deficiency .

Recombinant Production

Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells . These recombinant proteins are valuable for research purposes, such as studying enzyme kinetics, structure-function relationships, and drug development .

The availability of recombinant HSD3B in different forms (e.g., with Avi-tag for biotinylation) allows for diverse applications in biochemical assays and protein interaction studies .

Antibodies and Research Tools

Various antibodies target 3β-HSD, facilitating its detection and study in different tissues and species . These antibodies are valuable tools for immunohistochemistry, Western blotting, and other immunodetection techniques.

AntibodySourceApplication
Goat anti-3β-HSD antibodySanta CruzImmunohistochemistry, Western blotting
Rabbit polyclonal anti-3βHSDUniversity of EdinburghDetection of 3βHSD in tissues
Anti-3βHSDAbcamWestern blotting, other immunodetection methods

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Equus caballus (Horse)
Target Names
HSD3B
Target Protein Sequence
AGWSCLVTGAGGFLGQRIVRLLVEEKEVQEIRALDKVFRPELREEFSKLQSKVKLTVLEG DILDEQFLKRACQGASAVIHTASIIDVTNLFNPQVTMNVNVEGTQLLLEACSQASVPIFI YTSSVAVAGPNSYREIIQNGHEEAHLETKWSSPYPYSKKLAEKAVLAANGLPLKNGGTLY TCALRPMFIYGEGSPTLYYLMHEGLNNNGILTHNCKFSRANPVYVGNIAWAHIMALRALR DPKKAPSIQGQFYYISDDTPPQSYDDLTYTLSKKWGFCLDSRMRLPIFLKYWLAFLLEIV SFLLSPIYKYRPPFDRHLVTWQNSVFTFSYKKAQRDMGYEPLFSWEEAKKRTTEWIDALV EPHQEALKTKTL
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a critical role in the biosynthesis of all classes of steroid hormones.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the biological role of 3 beta-hydroxysteroid dehydrogenase in steroidogenesis?

The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. It catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroids into delta-4-3-ketosteroids, a critical step in the production of progesterone, mineralocorticoids, glucocorticoids, androgens, and estrogens . In reproductive tissues, HSD3B is essential for normal steroid hormone production, with different isoforms showing tissue-specific expression patterns. In humans, HSD3B1 is expressed predominantly in the placenta and peripheral tissues, while HSD3B2 is expressed primarily in steroidogenic tissues including the adrenal gland, ovary, and testis .

The enzyme functions as a critical marker for functional steroidogenic cells. For example, in primate testes, HSD3B serves as a specific marker for identifying Leydig cells, which are the primary testosterone-producing cells in males . Understanding the expression patterns and activity of HSD3B provides crucial insights into reproductive development and hormone-dependent physiological processes.

What are the methodological approaches for detecting and quantifying HSD3B activity in tissue samples?

Immunohistochemical Detection:
The gold standard for localizing HSD3B in tissue samples is immunohistochemistry using specific antibodies. A robust protocol involves:

  • Tissue fixation in appropriate fixatives (e.g., Bouin's solution for reproductive tissues)

  • Paraffin embedding and sectioning (typically 5 μm thickness)

  • Deparaffinization and rehydration

  • Antigen retrieval if necessary

  • Blocking endogenous peroxidase activity

  • Primary antibody incubation (anti-HSD3B antibody)

  • Secondary antibody application (biotinylated anti-rabbit/mouse IgG)

  • Signal amplification using avidin-biotin complex (ABC)

  • Chromogen development with 3,3-diaminobenzidine (DAB)

  • Counterstaining with hematoxylin or PAS-hematoxylin

  • Dehydration and mounting

HSD3B positive cells display dark brown cytoplasmic staining, allowing for their identification and quantification in tissue sections. For controls, primary antibody is omitted or replaced with normal serum .

Enzyme Activity Assays:
For direct measurement of enzymatic activity:

  • Spectrophotometric assays measuring NAD+ to NADH conversion

  • Radiometric assays using tritiated substrates

  • Mass spectrometry-based approaches quantifying substrate-to-product conversion

ELISA-Based Quantification:
For protein level quantification, sensitive ELISA kits can detect HSD3B with high specificity. These typically employ a biotin-conjugated antibody specific to HSD3B, followed by avidin-HRP conjugate and colorimetric detection .

How do recombinant HSD3B proteins differ from native enzymes in terms of activity and stability?

Recombinant HSD3B proteins are valuable research tools but may exhibit differences from native enzymes:

ParameterNative HSD3BRecombinant HSD3BMethodological Implications
Post-translational modificationsComplete physiological modificationsMay lack certain modifications depending on expression systemMay affect enzyme kinetics and substrate specificity
Membrane associationNaturally associated with endoplasmic reticulumOften produced as soluble proteinsRequires consideration in activity assays
StabilityStabilized in cellular environmentVariable stability based on purification and storage conditionsRequires optimized buffer conditions
Specific activityConsistent in physiological contextMay vary between preparationsNecessitates batch-to-batch validation
Isoform purityMixed isoforms in tissue extractsSingle isoform can be producedAllows for isoform-specific studies

For optimal activity preservation, recombinant HSD3B typically requires stabilizing agents and appropriate storage conditions (-80°C for long-term storage, with minimized freeze-thaw cycles) .

What are the most effective expression systems for producing functionally active recombinant horse HSD3B?

Several expression systems can be employed for recombinant horse HSD3B production, each with distinct advantages:

Bacterial Expression (E. coli):

  • Advantages: High yield, cost-effective, rapid production

  • Limitations: Lack of post-translational modifications, potential inclusion body formation

  • Optimization strategies: Use of specialized strains, fusion tags (e.g., His-tag, GST), and lower induction temperatures

Mammalian Cell Expression:

  • Advantages: Proper protein folding, post-translational modifications

  • Limitations: Lower yield, higher cost, longer production time

  • Best for: Studies requiring fully functional enzyme with native-like activity

Baculovirus-Insect Cell System:

  • Advantages: Higher yield than mammalian cells, proper folding, some post-translational modifications

  • Limitations: More complex than bacterial systems

  • Particularly suitable for: Structural studies requiring properly folded protein

When selecting an expression system, researchers should consider whether enzymatic activity or high protein yield is the priority. For functional studies of horse HSD3B, mammalian expression systems typically provide the most physiologically relevant enzyme preparations, though E. coli systems can be optimized with solubility tags as demonstrated with other HSD3B variants .

What purification strategies yield the highest specific activity for recombinant horse HSD3B?

A systematic purification approach for obtaining high-activity recombinant horse HSD3B typically involves:

  • Affinity Chromatography:

    • His-tag purification using Ni-NTA columns for His-tagged variants

    • Careful optimization of imidazole concentration in elution buffers to minimize non-specific binding

  • Ion Exchange Chromatography:

    • Further purification based on HSD3B's isoelectric point

    • Typically anion exchange (Q-Sepharose) with pH-optimized buffers

  • Size Exclusion Chromatography:

    • Final polishing step to separate monomeric from aggregated forms

    • Critical for removing high molecular weight contaminants

Activity-Preserving Considerations:

  • Inclusion of reducing agents (1-5 mM DTT or β-mercaptoethanol) in all buffers

  • Addition of glycerol (10-20%) to maintain protein stability

  • Temperature control during purification (4°C)

  • Inclusion of protease inhibitors to prevent degradation

Purity Assessment:

  • SDS-PAGE analysis (>85% purity is typically achievable)

  • Western blotting with anti-HSD3B antibodies for identity confirmation

  • Enzymatic activity assays at each purification step to track specific activity

How can recombinant horse HSD3B be effectively used in reproductive biology research?

Recombinant horse HSD3B serves as a valuable tool in multiple research applications:

Steroidogenic Pathway Analysis:

  • In vitro reconstitution of steroidogenic pathways

  • Substrate specificity studies comparing horse HSD3B with other species

  • Inhibitor screening and characterization

Antibody Production and Validation:

  • Generation of specific antibodies against horse HSD3B isoforms

  • Validation of cross-reactivity between species

  • Development of immunoassays specific for equine samples

Structural Biology:

  • Crystallization studies for structure determination

  • Structure-function relationship analysis

  • Comparative studies with human HSD3B for evolutionary insights

Reproductive Physiology:

  • Investigation of seasonal breeding patterns unique to equids

  • Analysis of steroidogenic capacity during different reproductive states

  • Correlation of enzyme activity with follicular development in mares

Experimental Design Considerations:

  • Always include appropriate controls (inactive enzyme variants, no-enzyme controls)

  • Verify enzyme activity before experiments using standardized assays

  • Consider species-specific differences when extrapolating from other models

What are the most effective methods for studying HSD3B regulation in equine models?

Research into HSD3B regulation requires carefully designed experimental approaches:

In Vitro Regulatory Studies:

  • Primary cell cultures from equine gonads or adrenal tissue

  • Treatment with potential regulatory hormones (LH, FSH, ACTH)

  • Quantification of HSD3B at mRNA level (qRT-PCR) and protein level (Western blot/ELISA)

  • Activity assays to correlate expression with function

LH and FSH have been demonstrated to significantly influence HSD3B-positive cell populations in primate models, with LH stimulation (alone or in combination with FSH) resulting in 20-30 fold increases in HSD3B-positive cells. Interestingly, FSH alone can also induce HSD3B expression, though to a lesser extent than LH .

In Vivo Approaches:

  • Hormone stimulation studies (e.g., GnRH agonist treatment)

  • Collection of tissue samples at various stages of the estrous cycle

  • Immunohistochemical quantification of HSD3B-positive cells

  • Correlation with circulating hormone levels

Promoter Activity Analysis:

  • Cloning of the horse HSD3B promoter region into reporter constructs

  • Site-directed mutagenesis of potential regulatory elements

  • Transfection studies in relevant cell lines

  • Response to hormone treatment and transcription factor overexpression

When designing studies on HSD3B regulation, researchers should consider the nuclear diameter of HSD3B-positive cells as an indicator of functional status, as this parameter increases significantly during developmental activation .

What experimental challenges are commonly encountered when working with recombinant horse HSD3B and how can they be addressed?

Challenge 1: Enzyme Stability

  • Problem: Loss of activity during storage or experimental handling

  • Solution: Store enzyme at -80°C in buffer containing 20% glycerol, 1mM DTT, and protease inhibitors

  • Validation: Regular activity assays to confirm enzyme functionality

Challenge 2: Species-Specific Antibody Availability

  • Problem: Limited availability of horse-specific HSD3B antibodies

  • Solution: Validate cross-reactivity of antibodies raised against human or other mammalian HSD3B

  • Alternative: Generate custom antibodies using recombinant horse HSD3B as immunogen

Challenge 3: Membrane Association

  • Problem: Native HSD3B is membrane-associated, affecting activity in solution

  • Solution: Use of detergents (0.1% Triton X-100) or lipid reconstitution systems

  • Consideration: Different detergents may differentially affect activity

Challenge 4: Multiple Isoforms

  • Problem: Horses may express multiple HSD3B isoforms with overlapping functions

  • Solution: Isoform-specific primers for qPCR; isoform-specific antibodies if available

  • Approach: Recombinant expression of each isoform separately for comparative studies

Challenge 5: Cofactor Requirements

  • Problem: Suboptimal activity due to incorrect cofactor concentration

  • Solution: Optimize NAD+/NADPH concentrations in activity assays

  • Method: Kinetic analysis with varying cofactor concentrations

How does the structure and function of horse HSD3B compare with that of other species?

Comparative analysis of HSD3B across species provides evolutionary and functional insights:

SpeciesKey Structural FeaturesFunctional DifferencesResearch Implications
HorseUnder-characterized compared to other speciesPotentially adapted to seasonal breeding patternsImportant for comparative endocrinology
HumanTwo main isoforms (HSD3B1 & HSD3B2) with tissue-specific distributionHSD3B2 predominant in gonads and adrenal; HSD3B1 in placenta and peripheral tissuesModel for understanding isoform specialization
PrimatesSimilar to humans with variations in regulatory elementsDevelopmental regulation during puberty with LH/FSH sensitivityInsights into hormonal regulation of expression
RodentsMultiple isoforms (up to 6 in mice)Different tissue distribution pattern than primatesCaution needed when extrapolating from rodent models
Vaccinia virusViral HSD3B homolog with unique featuresPotentially involved in viral pathogenesisTool for studying minimal functional domains

While specific information on horse HSD3B structure-function relationships is limited in the literature, researchers can leverage comparative approaches to make predictions. Sequence homology analysis between horse and human HSD3B isoforms would be a valuable starting point for structure-function studies.

What role do genetic polymorphisms in HSD3B play in reproductive disorders, and how can recombinant variants help study these?

Genetic variations in HSD3B genes have been associated with various disorders:

Known Associations in Humans:

  • HSD3B2 variants are associated with increased bladder cancer risk (adjusted OR 1.85 95%CI 1.31–2.62), with stronger effects observed in males (OR 2.13 95%CI 1.40–3.25) compared to females (OR 1.56 95%CI 0.83–2.95)

  • Polymorphisms can affect hormone-dependent pathways, potentially influencing disease susceptibility

  • Sex-specific effects suggest interactions with hormone regulation pathways

Research Applications with Recombinant Variants:

  • Express recombinant horse HSD3B variants containing polymorphisms of interest

  • Perform enzyme kinetic studies to determine effects on:

    • Substrate affinity (Km)

    • Maximum reaction velocity (Vmax)

    • Cofactor preference

    • Inhibitor sensitivity

  • Study protein stability and subcellular localization of variant enzymes

  • Investigate potential changes in regulatory responses (e.g., hormone responsiveness)

Methodological Approach:

  • Site-directed mutagenesis of wild-type recombinant horse HSD3B

  • Parallel expression and purification of wild-type and variant enzymes

  • Side-by-side functional characterization under identical conditions

  • Correlation with clinical/phenotypic data from horses carrying these variants

This research area represents an important intersection between molecular enzymology and clinical veterinary sciences, potentially informing both basic science and applied aspects of equine reproductive health.

How can advanced imaging techniques be combined with recombinant HSD3B to study steroidogenic cell dynamics?

Integration of recombinant HSD3B with imaging approaches enables sophisticated investigation of steroidogenic processes:

Fluorescently-Tagged Recombinant HSD3B:

  • Generation of GFP or other fluorophore-tagged recombinant horse HSD3B

  • Transfection into primary equine steroidogenic cells

  • Live-cell imaging to track subcellular localization and trafficking

  • FRAP (Fluorescence Recovery After Photobleaching) to study membrane dynamics

Super-Resolution Microscopy Applications:

  • STORM or PALM imaging to visualize HSD3B distribution at nanoscale resolution

  • Co-localization studies with other steroidogenic enzymes

  • Quantitative analysis of spatial organization within the endoplasmic reticulum

Multi-Modal Approaches:

  • Combination of HSD3B immunolocalization with BrdU labeling to study proliferation of steroidogenic cells

  • Correlation of HSD3B expression with S-phase labeling in interstitial cells

  • Analysis of nuclear diameter as an indicator of cellular maturation and activation status

Experimental Considerations:

  • Ensure that fluorescent tags do not interfere with enzyme activity or localization

  • Include appropriate controls (inactive mutants, untagged proteins)

  • Validate findings in primary cells with endogenous expression

  • Consider tissue-specific differences in subcellular organization

These advanced imaging approaches can reveal dynamic aspects of steroidogenic cell function that are not accessible through biochemical methods alone.

What are the optimal analytical methods for determining the enzymatic activity of recombinant horse HSD3B?

Precise measurement of HSD3B activity requires carefully optimized analytical methods:

Spectrophotometric Assays:

  • Principle: Measure increase in NADH absorbance at 340 nm during reaction

  • Advantages: Simple, real-time kinetics, minimal equipment needed

  • Limitations: Lower sensitivity, potential interference from sample components

  • Protocol outline:

    • Prepare reaction buffer (100 mM Tris-HCl pH 7.4, 1 mM NAD+)

    • Add substrate (pregnenolone or other delta-5-steroid, 10-50 μM)

    • Initiate reaction with recombinant HSD3B

    • Monitor absorbance change at 340 nm

    • Calculate activity using NADH extinction coefficient (6220 M⁻¹cm⁻¹)

Chromatography-Based Methods:

  • HPLC separation of substrates and products

  • LC-MS/MS for highest sensitivity and specificity

  • Advantages: Direct measurement of substrate conversion, highly specific

  • Protocol considerations:

    • Quench reactions with organic solvent (methanol or acetonitrile)

    • Extract steroids from reaction mixture

    • Analyze by HPLC or LC-MS/MS with appropriate standards

    • Quantify using calibration curves

Radiometric Assays:

  • Use of radiolabeled substrates (³H or ¹⁴C-labeled steroids)

  • Separation of substrate and product by TLC or HPLC

  • Quantification by scintillation counting

  • Highest sensitivity for low enzyme concentrations

When selecting an analytical method, researchers should consider the specific research question, required sensitivity, available equipment, and potential interfering substances in the reaction matrix.

How can researchers accurately quantify the expression of HSD3B in equine tissue samples?

Accurate quantification of HSD3B in tissue samples involves complementary approaches:

Immunohistochemical Quantification:
The point-counting method offers a robust approach for enumerating HSD3B-positive cells:

  • Superimpose a grid of intersecting lines (e.g., 20×20 eyepiece graticule) over tissue sections

  • Count test points falling over nuclei of HSD3B-positive cells across 25 randomly chosen fields (40X magnification)

  • Convert to percentage of total points per animal

  • Calculate nuclear diameter by measuring two perpendicular diameters for each nucleus (average 25 nuclei per animal)

  • Calculate total Leydig cell number using nuclear volume and testis volume values

mRNA Quantification:

  • Quantitative RT-PCR with isoform-specific primers

  • RNA-Seq for comprehensive transcriptomic profiling

  • Normalization to appropriate reference genes specific for equine tissues

Protein Quantification:

  • Western blotting with densitometric analysis

  • ELISA assays using the sandwich principle with biotin-conjugated antibodies specific to HSD3B

  • Liquid chromatography-mass spectrometry for absolute quantification

Methodology for ELISA-Based Quantification:

  • Add samples or standards to microplate wells coated with capture antibody

  • Add biotin-conjugated antibody specific to HSD3B

  • Add Avidin-HRP conjugate and incubate

  • Add TMB substrate solution and measure color change at 450nm

  • Determine concentration by comparing to standard curve

When conducting quantitative studies, researchers should be aware that HSD3B expression varies significantly with developmental stage and can be dramatically influenced by hormonal stimulation, as demonstrated in primate models where LH treatment resulted in 20-30 fold increases in HSD3B-positive cells .

How is HSD3B expression regulated during different developmental stages?

HSD3B expression undergoes significant developmental regulation:

Prenatal Development:

  • Expression patterns establish during gonadal differentiation

  • Critical for initiation of steroidogenesis in developing gonads

  • Regulated by developmental transcription factors

Prepubertal Stage:

  • Low or absent expression in prepubertal testes

  • The absence of HSD3B positive cells in mid-juvenile primate testes has been documented, confirming minimal steroidogenic activity during this phase

Pubertal Transition:

  • Dramatic upregulation during puberty

  • In primates, Leydig cell number per testis increases progressively during puberty

  • Adult values reach approximately 10-fold greater than early pubertal animals

  • Increase in cell number accompanied by increased nuclear diameter, indicating cellular maturation

Hormonal Regulation During Development:

  • LH appears to be the primary driver of pubertal expansion of HSD3B-positive cells

  • Experimental stimulation with LH (alone or with FSH) results in 20-30 fold increases in HSD3B-positive cells

  • FSH alone can induce some HSD3B expression, though at lower levels

  • Interestingly, nuclear diameter of HSD3B-positive cells induced by LH is greater than those generated by FSH alone

These developmental patterns highlight the importance of precise hormonal regulation of HSD3B expression during critical life stages.

What experimental approaches can reveal the transcriptional and post-translational regulation of HSD3B?

Understanding HSD3B regulation requires multi-level experimental approaches:

Transcriptional Regulation:

  • Promoter Analysis:

    • Cloning of 5'-flanking regions (approximately 1000 bp) into reporter vectors

    • Site-directed mutagenesis of potential regulatory elements

    • Luciferase reporter assays in relevant cell lines

    • Deletion analysis to map minimal promoter regions

  • Transcription Factor Studies:

    • Chromatin immunoprecipitation (ChIP) to identify factors binding to the HSD3B promoter

    • Electrophoretic mobility shift assays (EMSA) to confirm binding interactions

    • Overexpression and knockdown of candidate transcription factors

  • Epigenetic Regulation:

    • Bisulfite sequencing to assess DNA methylation status

    • ChIP for histone modifications across the HSD3B locus

    • Treatment with epigenetic modifiers to determine impact on expression

Post-Translational Regulation:

  • Phosphorylation Studies:

    • Mass spectrometry to identify phosphorylation sites

    • Site-directed mutagenesis of potential phosphorylation sites

    • In vitro kinase assays to identify responsible kinases

    • Functional impact assessment on enzyme activity and stability

  • Protein-Protein Interactions:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid or mammalian two-hybrid screening

    • FRET/BRET analyses for interaction dynamics in living cells

  • Subcellular Localization:

    • Fractionation studies combined with Western blotting

    • Immunofluorescence microscopy with organelle markers

    • Effects of cellular stressors on localization patterns

These methodological approaches can reveal the complex regulatory networks controlling HSD3B expression and activity, providing insights into both physiological regulation and potential dysregulation in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.