Recombinant Horse Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal quality, aliquot the protein for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling it during development.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
Full length protein
Species
Equus caballus (Horse)
Target Names
AQP2
Target Protein Sequence
SIAFSRAVLAEFLATLLFVFFGLGSALNWPQAMPSVLQIAMAFGLAIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPPDIRR
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel that enhances the permeability of water through the plasma membranes of renal collecting duct cells. This facilitates water movement along osmotic gradients, contributing to the regulation of water balance in the body.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the structure of horse AQP2 and how does it compare to human AQP2?

Horse AQP2, like human AQP2, belongs to the aquaporin family of membrane water channels and likely maintains the conserved homotetrameric structure seen in human AQP2. The human AQP2 structure has been determined at 2.75 Å resolution using X-ray crystallography, revealing important features such as the water-conducting pore and regulatory domains . For horse AQP2 structural characterization, researchers should consider using similar crystallographic approaches while accounting for potential species-specific differences in the C-terminal region, which in human AQP2 displays multiple conformations that may be involved in protein-protein interactions critical for cellular sorting . Comparative structural analysis between horse and human AQP2 would require expression, purification, and crystallization of horse AQP2, followed by molecular modeling to identify conserved and divergent features.

What expression systems are most effective for producing recombinant horse AQP2?

Based on successful approaches with human AQP2, the baculovirus/insect cell system represents a promising expression platform for recombinant horse AQP2. This system has enabled large-scale production of functional human AQP2, yielding approximately 0.5 mg of purified protein per liter of bioreactor culture . Researchers should design a codon-optimized horse AQP2 gene construct with an affinity tag (such as a histidine tag) to facilitate purification. Alternative expression systems to consider include yeast (Pichia pastoris), which has been successfully used for expressing AQP2 mutants for functional studies , or mammalian cell lines that might provide more native-like post-translational modifications. When establishing an expression system, optimization of culture conditions including temperature, induction timing, and duration is essential for maintaining protein functionality.

How can the functionality of recombinant horse AQP2 be verified experimentally?

Functionality assessment of recombinant horse AQP2 can be conducted through several complementary approaches:

  • Proteoliposome water permeability assays: Reconstitute purified AQP2 into liposomes and measure water transport using stopped-flow light scattering techniques. Functional AQP2 should demonstrate significantly higher water permeability (Pₑ values) compared to control liposomes .

  • Cell-based assays: Express horse AQP2 in Xenopus oocytes or mammalian cell lines and measure osmotic water permeability through volume change measurements or fluorescent indicators .

  • Structural integrity assessment: Use circular dichroism (CD) spectroscopy to confirm proper protein folding by comparing spectra to those of known functional aquaporins .

A typical proteoliposome assay would involve subjecting AQP2-containing liposomes to an osmotic gradient followed by monitoring the rate of liposome shrinkage. Functional horse AQP2 should exhibit water permeability values comparable to those reported for human AQP2 (Pₑ = 0.21 ± 0.004 cm/s) .

What purification strategies yield high-purity recombinant horse AQP2?

Purification of recombinant horse AQP2 should employ a multi-step approach similar to that used for human AQP2:

  • Membrane extraction: Solubilize cell membranes containing expressed AQP2 using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or octyl glucoside) that maintain protein structural integrity.

  • Affinity chromatography: If a histidine tag was incorporated, use immobilized metal affinity chromatography (IMAC) for initial capture.

  • Size exclusion chromatography: Further purify the protein and confirm its tetrameric assembly state.

  • Quality control: Assess purity by SDS-PAGE and Western blotting, and verify tetrameric assembly by native PAGE or analytical ultracentrifugation.

Following this protocol, researchers have achieved approximately 0.5 mg of pure human AQP2 per liter of culture with retained tetrameric structure and water permeability . Careful selection of detergents is critical, as they must efficiently solubilize the protein while preserving its native structure and function.

How does horse AQP2 trafficking compare to the well-characterized human AQP2 system?

While horse-specific AQP2 trafficking has not been extensively characterized, the fundamental mechanisms likely parallel the human system, where AQP2 trafficking is regulated by arginine vasopressin (AVP). In humans, AVP binding to the V2 receptor increases intracellular cAMP, triggering protein kinase A (PKA) to phosphorylate Ser256 in the AQP2 C-terminus, flagging the protein for trafficking from storage vesicles to the apical membrane .

To investigate horse AQP2 trafficking:

  • Create fluorescently tagged horse AQP2 constructs for visualizing trafficking dynamics.

  • Develop horse-specific phospho-antibodies targeting predicted phosphorylation sites (likely conserved serines equivalent to human Ser256, Ser264, and Ser269).

  • Employ immunohistochemistry on equine kidney tissues using antibodies that recognize conserved AQP2 epitopes, similar to approaches used in canine studies .

Comparative analysis between species should focus on the C-terminal region, as this domain contains key phosphorylation sites and protein interaction motifs critical for regulated trafficking.

How do mutations in horse AQP2 affect protein structure and function?

Analyzing mutations in horse AQP2 requires understanding the parallel human AQP2 mutations that cause nephrogenic diabetes insipidus (NDI). The study of human AQP2 mutations T125M, T126M, and A147T has provided valuable insights:

MutationWater Permeability (% of WT)Structural ImpactClinical OutcomeT125M74.3%Minor structural changesNDI (recessive)T126M92.6%Minor structural changesNDI (recessive)A147T49.9%Reduced stabilityNDI (recessive)\begin{array}{|c|c|c|c|} \hline \text{Mutation} & \text{Water Permeability (\% of WT)} & \text{Structural Impact} & \text{Clinical Outcome} \\ \hline \text{T125M} & 74.3\% & \text{Minor structural changes} & \text{NDI (recessive)} \\ \hline \text{T126M} & 92.6\% & \text{Minor structural changes} & \text{NDI (recessive)} \\ \hline \text{A147T} & 49.9\% & \text{Reduced stability} & \text{NDI (recessive)} \\ \hline \end{array}

These human mutations, despite maintaining water permeability, cause ER retention due to minor misfolding or reduced stability . For horse AQP2 mutation analysis:

  • Identify equivalent residues in horse AQP2 through sequence alignment.

  • Generate site-directed mutants using recombinant expression systems.

  • Assess structural integrity via CD spectroscopy and thermal stability using nanoDSF.

  • Determine water permeability using proteoliposome assays.

  • Analyze subcellular localization in mammalian cell expression systems.

Such studies would provide insights into structure-function relationships in horse AQP2 and potential molecular mechanisms of equine renal disorders.

What crystallization techniques are most suitable for determining the high-resolution structure of horse AQP2?

Based on successful crystallization of human AQP2, researchers should consider the following approaches for horse AQP2:

  • Detergent screening: Test various detergents for optimal protein stability and monodispersity during purification and crystallization.

  • Lipidic cubic phase (LCP) crystallization: This technique has proven successful for membrane proteins including aquaporins, creating a membrane-like environment that may stabilize the native conformation.

  • Vapor diffusion methods: Systematically screen crystallization conditions varying precipitants, buffers, pH, temperature, and additives.

  • Crystal optimization: Employ techniques such as seeding, additive screening, and crystal dehydration to improve diffraction quality.

  • Protein engineering: Consider using fusion proteins (e.g., T4 lysozyme) or truncation constructs to facilitate crystal contacts.

The human AQP2 structure was determined at 2.75 Å resolution , providing a benchmark for horse AQP2 studies. Researchers should note that the C-terminal region of AQP2 displays conformational flexibility, which might complicate crystallization efforts and potentially require stabilization strategies.

How can post-translational modifications of horse AQP2 be characterized comprehensively?

Post-translational modifications (PTMs) of horse AQP2, particularly phosphorylation, are likely critical for its regulation. A comprehensive characterization approach would include:

  • Mass spectrometry analysis:

    • Phosphoproteomic analysis using titanium dioxide enrichment to identify phosphorylation sites

    • Glycoproteomics to characterize N-linked glycosylation patterns

    • Ubiquitylation analysis to understand degradation pathways

  • Site-specific mutational analysis:

    • Generate phospho-mimetic (S→D/E) and phospho-deficient (S→A) mutations at predicted regulatory sites

    • Assess impact on trafficking and function

  • Custom antibody development:

    • Develop horse-specific phospho-antibodies targeting predicted regulatory phosphorylation sites (equivalent to human Ser256, Ser264, and Ser269)

  • Dynamic PTM analysis:

    • Monitor changes in PTM patterns under various physiological stimuli (AVP stimulation, osmotic stress)

    • Correlate PTM patterns with subcellular localization

Understanding PTMs is essential for elucidating the molecular mechanisms governing horse AQP2 trafficking and regulation during normal water homeostasis and in pathological conditions.

What are the molecular mechanisms of protein-protein interactions in horse AQP2 trafficking?

The C-terminal region of human AQP2 is involved in protein-protein interactions critical for cellular sorting and trafficking . To elucidate these mechanisms in horse AQP2:

  • Identify interaction partners using:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID or APEX)

  • Map interaction domains through:

    • Truncation and deletion constructs

    • Site-directed mutagenesis targeting predicted interaction motifs

    • Peptide competition assays

  • Visualize trafficking complexes using:

    • Advanced microscopy techniques (FRET, BRET, or TIRF)

    • Live-cell imaging with fluorescently tagged constructs

  • Functional validation through:

    • siRNA knockdown of identified interaction partners

    • Overexpression of dominant-negative constructs

    • Peptide inhibitors targeting specific interactions

The human AQP2 structure revealed that the C-terminal α-helix of one protomer interacts with the cytoplasmic surface of a symmetry-related AQP2 molecule, suggesting potential protein-protein interactions involved in AQP2 sorting . Similar interaction mechanisms likely exist in horse AQP2, though species-specific differences may occur.

How can recombinant horse AQP2 be utilized to study equine renal disorders?

Recombinant horse AQP2 provides a valuable tool for investigating equine kidney diseases:

  • Develop diagnostic biomarkers:

    • Generate antibodies against horse AQP2 for immunohistochemistry

    • Establish ELISA assays for urinary AQP2 as a marker of renal function

    • Correlate AQP2 expression or trafficking defects with clinical parameters

  • Create cellular models:

    • Establish equine kidney cell lines expressing wild-type or mutant AQP2

    • Use CRISPR/Cas9 genome editing to introduce disease-associated mutations

    • Measure water transport capacity and response to therapeutic interventions

  • Therapeutic screening:

    • Test compounds that may rescue trafficking defects of mutant AQP2

    • Evaluate chemical chaperones that promote proper folding and ER exit

    • Identify molecules that modulate AQP2 abundance or phosphorylation

  • Comparative pathophysiology:

    • Compare horse AQP2 regulation with human AQP2 to identify conserved mechanisms

    • Determine if conditions affecting AQP2 in humans (heart failure, liver cirrhosis, pre-eclampsia) have similar impacts in horses

This research would contribute to understanding equine polyuria/polydipsia syndromes, renal failure, and water balance disorders in horses, potentially leading to improved diagnostic and therapeutic approaches.

What are the key differences in experimental approaches needed for horse AQP2 versus human AQP2?

Working with horse AQP2 presents several species-specific challenges:

  • Expression optimizations:

    • Codon optimization for the selected expression system must account for horse-specific codon usage

    • Signal peptide modifications may be necessary for efficient membrane targeting

    • Expression temperature and induction conditions likely require specific optimization

  • Antibody availability:

    • Limited availability of horse-specific antibodies necessitates validation of cross-reactivity with existing antibodies

    • Development of custom antibodies against horse-specific epitopes may be required

    • Epitope selection should consider sequence divergence from human AQP2

  • Functional assays:

    • Water permeability benchmarks established for human AQP2 may not directly apply to horse AQP2

    • Regulatory pathways might exhibit species-specific differences requiring modified experimental designs

    • Cell lines of equine origin may be needed for physiologically relevant trafficking studies

  • Structural analysis:

    • Potential differences in detergent stability compared to human AQP2

    • Crystallization conditions successful for human AQP2 may require significant modification

    • Species-specific post-translational modifications might affect structural studies

Researchers should adopt an iterative approach, initially applying methods established for human AQP2 while systematically identifying and addressing horse-specific requirements.

How can contradictory experimental results regarding AQP2 function be reconciled?

Contradictory results in AQP2 research, such as the discrepancies in mutant functionality observed between different experimental systems , require careful methodological considerations:

  • System-dependent variations:

    • Different expression systems (oocytes, CHO cells, yeast, proteoliposomes) may yield varying results due to distinct membrane environments and cellular machinery

    • For example, AQP2 mutants showed different relative water permeability in oocytes versus proteoliposomes

  • Reconciliation strategies:

    • Employ multiple complementary assay systems in parallel

    • Standardize protein quantification methods across experiments

    • Control for membrane integration efficiency and surface expression

    • Consider native lipid environment effects on channel function

  • Data integration approach:

    • Assess relative rather than absolute function between systems

    • Develop mathematical models to normalize data across platforms

    • Establish clear criteria for functional versus non-functional channels

  • Methodological transparency:

    • Thoroughly document experimental conditions

    • Report all parameters that could influence results (temperature, pH, membrane composition)

    • Consider inadvertent selection pressures in expression systems

The reported discrepancies between oocyte and proteoliposome systems for AQP2 mutants (e.g., A147T showing 100% function in oocytes but only 49.9% in proteoliposomes) highlight the importance of system selection and methodological standardization.

What novel approaches could enhance our understanding of horse AQP2 regulation?

Emerging technologies offer new opportunities for studying horse AQP2:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structural determination

    • Visualize AQP2 in different conformational states or with binding partners

    • Study AQP2 in near-native membrane environments using nanodiscs

  • Advanced imaging:

    • Super-resolution microscopy to visualize trafficking dynamics

    • Light-sheet microscopy for 3D visualization in tissue samples

    • Correlative light and electron microscopy to link function with ultrastructure

  • Systems biology approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Model AQP2 regulation within broader signaling networks

    • Cross-species network analysis to identify conserved regulatory mechanisms

  • Organoid technology:

    • Develop equine kidney organoids expressing tagged AQP2

    • Study regulation in a physiologically relevant 3D environment

    • Test responses to physiological and pathological stimuli

These approaches would provide multi-scale insights from molecular structure to cellular dynamics, enhancing our understanding of horse AQP2 regulation in health and disease.

How might comparative studies between species inform AQP2 research?

Comparative analysis of AQP2 across species offers valuable insights:

SpeciesKidney StructureAQP2 Regulation FeaturesResearch ApplicationsHumanMultipyramidalWell-characterized AVP responseNDI, heart failure, cirrhosisDogUnipyramidalStudied in CKD modelsSpontaneous kidney diseasesHorseSmooth, bean-shapedLimited characterizationEquine-specific renal disordersRodentUnipapillaryExtensive genetic modelsMechanistic studies\begin{array}{|c|c|c|c|} \hline \text{Species} & \text{Kidney Structure} & \text{AQP2 Regulation Features} & \text{Research Applications} \\ \hline \text{Human} & \text{Multipyramidal} & \text{Well-characterized AVP response} & \text{NDI, heart failure, cirrhosis} \\ \hline \text{Dog} & \text{Unipyramidal} & \text{Studied in CKD models} & \text{Spontaneous kidney diseases} \\ \hline \text{Horse} & \text{Smooth, bean-shaped} & \text{Limited characterization} & \text{Equine-specific renal disorders} \\ \hline \text{Rodent} & \text{Unipapillary} & \text{Extensive genetic models} & \text{Mechanistic studies} \\ \hline \end{array}

Comparative approaches should:

  • Identify conserved functional domains:

    • Align sequences across species to identify invariant residues

    • Focus on conserved regulatory motifs as essential functional elements

    • Investigate species-specific variations that might relate to physiological differences

  • Correlate structural differences with functional adaptations:

    • Compare water permeability rates across species

    • Relate differences to evolutionary adaptations (desert vs. aquatic habitats)

    • Investigate species-specific trafficking regulatory mechanisms

  • Utilize natural variants as experimental models:

    • Study species with extreme water conservation adaptations

    • Identify natural AQP2 variants with enhanced functionality

    • Use comparative pharmacology to develop species-specific therapies

Cross-species studies are particularly valuable given the noted differences in kidney structure between humans (multipyramidal) and dogs (unipyramidal) , which may influence water handling and AQP2 regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.