Recombinant Horse Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

ALOX5AP is an 18–22 kDa integral membrane protein that anchors ALOX5 to cellular membranes, enabling efficient catalysis of arachidonic acid into leukotrienes (e.g., LTB4, LTC4) . Key features include:

  • Structural domains:

    • N-terminal C2-like domain: Mediates calcium-dependent membrane binding and substrate presentation .

    • PLAT domain: Regulates substrate access to ALOX5 .

    • Arachidonate-binding site: Essential for transferring arachidonic acid to ALOX5 .

Recombinant versions are produced using systems like E. coli, yeast, or mammalian cells to ensure proper folding and post-translational modifications .

Comparative Analysis Across Species

Functional conservation of ALOX5AP across mammals allows extrapolation of equine properties:

SpeciesGene LengthProtein SizeKey Role
Human (Homo sapiens)50.95 kb161 aaLeukotriene synthesis, inflammation
Pig (Sus scrofa)71.9 kb673 aaMembrane anchoring, arachidonate transfer
Horse (Equus caballus)N/A~160–180 aa*Hypothesized similar roles in immune response

*Predicted based on homology .

Research Applications

Recombinant ALOX5AP is pivotal in:

  • Inflammation studies: Investigating leukotriene-driven pathologies (e.g., asthma, arthritis) .

  • Drug discovery: Screening inhibitors like MK-886 that block FLAP-ALOX5 interaction .

  • Structural biology: Mapping arachidonate-binding sites using photoaffinity analogs .

Challenges and Innovations

  • Species-specific variability: Equine ALOX5AP may exhibit unique kinetic properties compared to human or murine forms .

  • Therapeutic targeting: Studies suggest combinatorial approaches (e.g., NAC + PGE2) to modulate ALOX5-derived lipid toxicity .

Future Directions

  • Functional assays: Develop equine-specific models to validate leukotriene synthesis pathways.

  • Clinical relevance: Explore associations with equine inflammatory diseases (e.g., recurrent airway obstruction).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Equus caballus (Horse)
Target Names
Target Protein Sequence
MDQETVGNVVLLAIVTLISVIQNGFFAHKVEHESKTQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLVMLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERRQSTPGYIFGKRIIL FLFLMSLAGIFNYYLILFFGSDFENYIKTITTT
Uniprot No.

Target Background

Function

Recombinant Horse Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) is required for leukotriene biosynthesis via ALOX5 (5-lipoxygenase). It anchors ALOX5 to the cell membrane and binds arachidonic acid, playing a crucial role in arachidonic acid transfer to ALOX5. Furthermore, ALOX5AP binds MK-886, an inhibitor of leukotriene biosynthesis.

Database Links
Protein Families
MAPEG family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Horse Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)?

Horse ALOX5AP (P30353) is an integral membrane protein consisting of 153 amino acids with a structure similar to its human homolog. The protein contains four transmembrane alpha helices that typically form a trimer in a barrel-like structure approximately 60 Å high and 36 Å wide .

ALOX5AP functions primarily as:

  • A membrane anchor for 5-lipoxygenase (5-LO/ALOX5)

  • A facilitator for arachidonic acid transfer to 5-lipoxygenase

  • A necessary cofactor for leukotriene biosynthesis

While the exact mechanism of activation remains incompletely understood, physical interaction between ALOX5AP and 5-lipoxygenase is essential for proper enzymatic function .

Expression Systems and Protein Characteristics

How does equine ALOX5AP compare to human ALOX5AP, and what are the implications for cross-species research models?

Comparative analysis reveals significant homology between equine and human ALOX5AP:

  • Equine ALOX5AP (P30353) shares approximately 83% sequence identity with human ALOX5AP (P20292)

  • Functional domains, particularly those involved in arachidonic acid binding and 5-LO interaction, are highly conserved

  • The amino acid sequence of equine ALOX5AP (153 residues) differs slightly from human ALOX5AP (161 residues)

Key research implications:

  • Horse models can provide valuable insights for human inflammatory pathway research

  • Inhibitor studies using equine models may have translational potential for human applications

  • Species-specific differences should be considered when interpreting experimental results or developing targeted therapeutics

What are the evidence-based protocols for maintaining stability and activity of recombinant Horse ALOX5AP?

Research indicates the following optimal conditions for maintaining recombinant ALOX5AP stability:

  • Long-term storage: -80°C in buffer containing glycerol (typically 10-50%) or lyophilized form

  • Working storage: -20°C for up to six months in liquid form

  • Reconstitution: For lyophilized proteins, reconstitution in sterile buffer at 0.2 μg/μl concentration followed by gentle mixing rather than vortexing

  • Handling: Avoid repeated freeze-thaw cycles; make single-use aliquots

  • Buffer composition: Tris-based buffers (pH 7.4) with stabilizing agents such as glycerol have demonstrated superior protein stability

Experimental data indicates that recombinant ALOX5AP activity decreases significantly after more than three freeze-thaw cycles .

What methodologies can verify the functional activity of recombinant Horse ALOX5AP in experimental settings?

Functional validation of recombinant Horse ALOX5AP requires assessing its ability to facilitate leukotriene biosynthesis:

  • Co-expression assays:

    • Co-express ALOX5AP with 5-lipoxygenase in cellular systems

    • Measure leukotriene production using LC-MS/MS or ELISA detection methods

    • Compare activity with and without ALOX5AP expression

  • Binding assays:

    • Assess binding to inhibitors like MK-886 using surface plasmon resonance

    • Quantify arachidonic acid binding through fluorescence displacement assays

  • Membrane incorporation:

    • Verify membrane localization using fractionation techniques followed by western blotting

    • Employ immunofluorescence to visualize cellular distribution

  • Enzyme activation:

    • Measure 5-LO translocation to membrane in presence of recombinant ALOX5AP

    • Quantify products of 5-LO activation (leukotrienes, 5-HETE) via ELISA (detection ranges typically 0.156-10 ng/ml)

How can researchers effectively analyze ALOX5AP expression in equine tissue samples?

Multiple techniques have been validated for ALOX5AP expression analysis in equine tissues:

  • RNA sequencing approach:

    • Next-generation sequencing for transcriptome-wide analysis

    • Able to detect splice variants and novel transcripts

    • Requires careful normalization and bioinformatic processing

  • Quantitative RT-PCR:

    • Primer design focusing on equine-specific sequences

    • Triplicate reactions with appropriate housekeeping genes

    • Can detect expression changes as low as 2-fold differences

  • Microarray analysis:

    • Equine-specific oligonucleotide arrays have been developed

    • Typically requires 5 μg of aminoallyl-amplified RNA

    • Validated for cross-hybridization studies comparing disease states

  • Protein detection:

    • Western blotting with specific antibodies

    • Immunohistochemistry for tissue localization

    • ELISA assays with sensitivity ranges of 0.05-0.1 ng/ml

How does ALOX5AP contribute to inflammatory pathways in equine models and what are the experimental approaches to study this?

ALOX5AP's role in equine inflammatory cascades can be studied through several approaches:

  • Leukotriene production analysis:

    • Measure LTB4 and other leukotrienes in equine tissues or cell cultures

    • Use HPLC or mass spectrometry for quantification

    • Compare production with and without ALOX5AP inhibitors

  • Gene knockdown/knockout approaches:

    • siRNA-mediated knockdown in equine cell cultures

    • CRISPR-Cas9 gene editing for studying functional consequences

    • Viral vector-mediated gene transfer (AAV vectors have shown efficacy)

  • Inhibitor studies:

    • Applications of ALOX5AP-specific inhibitors (e.g., MK-886)

    • Dose-dependent effects on inflammatory mediator production

    • Correlation between inhibition and physiological outcomes

  • Disease model development:

    • Equine models of respiratory inflammation

    • Joint inflammation and arthritic conditions

    • Correlation between ALOX5AP expression and disease progression

What methodologies are available for studying interactions between Horse ALOX5AP and 5-lipoxygenase?

Advanced techniques for analyzing protein-protein interactions include:

  • Co-immunoprecipitation:

    • Pull-down assays using tagged recombinant proteins

    • Western blotting to detect interaction partners

    • Requires validation with appropriate controls to confirm specificity

  • FRET (Fluorescence Resonance Energy Transfer):

    • Fluorescently labeled ALOX5AP and 5-LO

    • Real-time visualization of interactions in living cells

    • Quantitative measure of molecular proximity

  • Surface Plasmon Resonance:

    • Label-free detection of binding kinetics

    • Determination of association/dissociation constants

    • Requires purified recombinant proteins

  • Molecular modeling approaches:

    • In silico prediction of interaction surfaces

    • Molecular dynamics simulations

    • Structure-guided mutagenesis to validate predicted interfaces

These techniques can reveal detailed mechanisms of how equine ALOX5AP recruits and activates 5-lipoxygenase at the membrane surface.

What are the common technical challenges when working with recombinant Horse ALOX5AP and how can researchers overcome them?

ChallengePotential SolutionsExperimental Considerations
Low expression yieldsOptimize codon usage for expression system; Use fusion tags to improve solubility; Test different promotersExpression in insect cells has shown higher yields for membrane proteins
Poor membrane incorporationInclude appropriate detergents during purification; Consider nanodisc technology for membrane mimeticsDetergent screening is essential for maintaining native conformation
Protein aggregationAdd stabilizing agents (glycerol, trehalose); Optimize buffer conditions; Use lower protein concentrationsForm optimization requires empirical testing
Loss of function during purificationMild purification conditions; Use affinity tags positioned to minimize functional interferenceHis-tags at C-terminus have shown minimal interference with function
Inconsistent activity measurementsStandardize assay conditions; Include positive controls; Ensure appropriate reconstitutionConsider time-dependent activity changes after reconstitution

How can recombinant Horse ALOX5AP be utilized in studying inflammatory diseases relevant to both equine and comparative medicine?

Recombinant Horse ALOX5AP has significant applications in disease modeling:

  • Equine respiratory conditions:

    • Study of inflammatory mediators in equine asthma

    • Analyzing ALOX5AP expression patterns in affected tissues

    • Testing targeted inhibitors for therapeutic potential

  • Comparative oncology research:

    • Studies indicate ALOX5AP overexpression correlates with poor prognosis in ovarian cancer

    • Equine models may provide insights into conserved inflammatory pathways in tumorigenesis

    • Potential target for therapeutic intervention

  • Inflammatory joint conditions:

    • Role in equine arthritis through leukotriene production

    • Comparative analysis with human inflammatory conditions

    • Evaluation of anti-inflammatory interventions targeting this pathway

  • Cardiovascular research:

    • ALOX5AP polymorphisms have been linked to atherosclerosis and stroke risk in humans

    • Equine models may provide translational insights

    • Opportunity for comparative medicine approaches

What emerging techniques and research questions represent the frontier of Horse ALOX5AP research?

Current frontiers in equine ALOX5AP research include:

  • CRISPR-based approaches:

    • Precise genetic modifications to study structure-function relationships

    • Creation of reporter systems for real-time activity monitoring

    • Development of equine cell lines with modified ALOX5AP expression

  • Single-cell analysis:

    • Cell-specific expression patterns in different tissue microenvironments

    • Heterogeneity of ALOX5AP expression in disease states

    • Integration with spatial transcriptomics for tissue-level understanding

  • Systems biology approaches:

    • Network analysis of ALOX5AP interactions within inflammatory pathways

    • Multi-omics integration (transcriptomics, proteomics, lipidomics)

    • Computational modeling of leukotriene synthesis pathways

  • Translational applications:

    • Development of equine-specific ALOX5AP inhibitors

    • Validation of biomarkers for inflammatory conditions

    • Comparative medicine approaches leveraging conserved pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.