Recombinant Horse ATP synthase protein 8 (MT-ATP8)
Description
Introduction to MT-ATP8
MT-ATP8 (mitochondrially encoded ATP synthase membrane subunit 8) is a small but crucial component of the mitochondrial ATP synthase complex. This protein is encoded by the mitochondrial genome rather than nuclear DNA, making it subject to maternal inheritance patterns . The MT-ATP8 gene produces a protein that functions as an integral component of the F₀ region of ATP synthase, which is embedded in the inner mitochondrial membrane . This complex is responsible for catalyzing ATP synthesis by utilizing the electrochemical gradient of protons across the inner membrane during oxidative phosphorylation, a process fundamental to aerobic energy production .
In horses, as in other mammals, MT-ATP8 plays a critical role in energy metabolism, which is particularly relevant given the exceptional athletic demands placed on equine species, especially in breeds developed for racing and performance .
Expression Systems
Recombinant horse MT-ATP8 is primarily produced in bacterial expression systems, with Escherichia coli being the predominant host organism . The recombinant protein is typically expressed with an N-terminal histidine tag to facilitate purification and detection . This approach enables the production of significant quantities of the protein for research and analytical applications.
Purification and Quality Control
The recombinant protein undergoes purification processes that typically yield products with greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is commonly provided in lyophilized form with specific buffer compositions optimized for stability .
Role in ATP Synthesis
MT-ATP8 functions as a component of the ATP synthase complex, specifically within the F₀ region that forms a proton channel through the inner mitochondrial membrane . This complex is responsible for harnessing the energy from the proton gradient to synthesize ATP, the primary energy currency of cells . The precise contribution of MT-ATP8 appears to involve stabilizing the stator stalk structure, which is crucial for the rotational mechanism of ATP synthesis .
Contribution to Energy Metabolism
In horses, particularly those bred for athletic performance, efficient energy production is critical. The MT-ATP8 protein contributes to the oxidative phosphorylation system (OXPHOS), which is the metabolic pathway responsible for ATP generation . This pathway is especially important during sustained physical activity that relies heavily on aerobic metabolism .
Adaptive Evolution
Studies of mitochondrial genomes in horses have revealed that MT-ATP8 exhibits the highest dN/dS ratio (0.343) among mitochondrial genes in Thoroughbred racehorses . The dN/dS ratio measures the relative rates of nonsynonymous and synonymous substitutions, with high values indicating potential adaptive evolution . This finding suggests that MT-ATP8 has undergone selection pressure that favors amino acid changes, potentially contributing to adaptive advantages in energy metabolism .
Comparison with Other Species
Comparative analysis of MT-ATP8 across various species reveals evolutionary conservation of core functional domains alongside species-specific variations. The table below presents a comparison of MT-ATP8 protein lengths across selected species:
| Species | MT-ATP8 Length (amino acids) | Source |
|---|---|---|
| Horse | 67 | |
| American Alligator | 53 | |
| North American Opossum | 69 | |
| Human | 68 |
These variations in length and sequence suggest species-specific adaptations while maintaining the core functionality of the protein.
Biochemical and Functional Studies
Recombinant horse MT-ATP8 serves as a valuable tool for investigating the biochemical properties and functional characteristics of this protein . Applications include structure-function analyses, protein-protein interaction studies, and investigations into the mechanistic details of ATP synthesis.
Immunological Applications
Antibodies targeted against MT-ATP8, such as the commercially available MT-ATP8 (E2W1A) Rabbit mAb, enable detection of the protein in various experimental contexts including Western blotting and immunoprecipitation . These tools facilitate research into the expression, localization, and interactions of MT-ATP8 in cellular systems.
Relationship to Athletic Ability
Emerging research suggests a potential link between mitochondrial DNA variation, including that in the MT-ATP8 gene, and athletic performance in horses . Given the critical role of aerobic energy production in sustained physical activity, variations in genes encoding components of the oxidative phosphorylation machinery may influence performance capabilities .
Findings in Racing Breeds
Studies of Thoroughbred racehorses have identified MT-ATP8 as having the highest level of adaptive variation among mitochondrial genes . This elevated rate of nonsynonymous substitution suggests that changes in the amino acid sequence of MT-ATP8 may confer advantages related to energy metabolism, which could potentially influence racing performance .
The specific finding that ATP8 showed the highest dN/dS ratio while ND6 showed the most variable sequence highlights the distinct evolutionary pressures on different components of the mitochondrial genome in racing horses .
Studies in Holstein Horses
Research on Holstein mares has revealed considerable molecular variation among mitochondrial genomes of different maternal lineages . Since mitochondrial genes like MT-ATP8 are maternally inherited, this variation could potentially influence the aerobic capacity and thus the athletic performance of horses from different maternal lines .
Functional Genomics Approaches
Further investigation of the specific functional consequences of variations in the MT-ATP8 gene could provide deeper insights into the molecular basis of athletic performance in horses. Techniques such as site-directed mutagenesis of recombinant proteins could help elucidate the impact of specific amino acid changes on protein function.
Integrative Studies
Integrating genomic data with physiological measurements and performance metrics could yield a more comprehensive understanding of how mitochondrial variation, including in MT-ATP8, influences equine athletic ability. Such studies could potentially inform breeding programs aimed at enhancing specific performance traits.
Comparative Research
Expanded comparative studies of MT-ATP8 across different horse breeds and related species could further illuminate the evolutionary history and functional significance of this protein. Such research may reveal patterns of selection pressure related to different physiological demands and environmental adaptations.
Product Specs
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Note: All protein shipments are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: ecb:807849
STRING: 9796.ENSECAP00000023104
Q&A
What is MT-ATP8 and what is its role in mitochondrial function?
MT-ATP8 (ATP synthase protein 8) is a small mitochondrially encoded subunit of the ATP synthase complex. It is also known as A6L or F-ATPase subunit 8 . In horses, MT-ATP8 consists of 67 amino acids with the sequence: MPQLDTSTWFINIVSMILTLFIVFQLKISKHSYPTHPEVKTTKMTKHSAPWESKWTKIYSPLSLPQQ . This protein functions as part of the F0 sector of ATP synthase, which facilitates proton movement across the inner mitochondrial membrane, driving ATP synthesis. The recombinant version of horse MT-ATP8 is typically produced with an N-terminal His-tag in E. coli expression systems for research purposes .
How does horse MT-ATP8 sequence compare with other species?
Sequence comparison reveals both conservation and variation across species:
The N-terminal region shows significant conservation (MPQLDTSTW) between horse and whale sequences, suggesting functional importance, while C-terminal regions display greater variation . These differences may reflect species-specific adaptations to different metabolic demands.
How is the MT-ATP8 gene organized in the mitochondrial genome?
The MT-ATP8 gene is located in the mitochondrial genome and is part of a bicistronic transcript with ATP6 . In mitochondrial gene organization studies, researchers have observed that the MT-ATP8/ATP6 genes are co-transcribed, with ATP8 typically preceding ATP6 in the transcript . This arrangement is evolutionarily conserved across many species, though some organisms were previously thought to lack ATP8 . Recent analysis supports that ATP8 is present in Mytilidae, contrary to earlier annotations . The close association between ATP8 and ATP6 suggests coordinated expression and function within the ATP synthase complex.
What is known about the evolution of MT-ATP8 in equids?
Mitochondrial genome analyses have provided insights into MT-ATP8 evolution in horses. Research indicates that the Ancestral Mare Mitogenome dates to approximately 130-160 thousand years ago . Modern horses display 18 major haplogroups (A-R) with radiation times mostly confined to the Neolithic and later periods . Interestingly, while all haplogroups were detected in modern horses from Asia, haplogroup F was found only in Equus przewalskii (the only remaining wild horse) .
The MT-ATP8 gene shows a high density of non-synonymous substitutions compared to other mitochondrial genes, suggesting it may be under positive selection in horses . This could indicate functional adaptation related to energy metabolism during horse domestication and breed development .
How is MT-ATP8 expression regulated in mitochondria?
Research has revealed a sophisticated translational regulation mechanism for MT-ATP8 expression. Studies show that translation of both ATP6p and ATP8p is activated by F1 ATPase or its assembly intermediates . Key findings include:
-
F1 mutants (lacking α or β subunits) or assembly chaperone mutants (lacking Atp11p or Atp12p) fail to synthesize ATP8p despite normal levels of ATP8/ATP6 mRNAs
-
When ATP8 was replaced with ARG8m (a mitochondrial reporter gene), expression was compromised in F1 mutants, confirming translational regulation
-
ATP22, an ATP6p-specific translational activator, can act as a suppressor of the Atp6p translation defect in F1 mutants and can also partially rescue ATP8p synthesis
This regulatory mechanism ensures coordinated expression of nuclear-encoded F1 components and mitochondrially-encoded F0 components, preventing accumulation of unassembled subunits . The translational control represents a critical checkpoint in the biogenesis of the ATP synthase complex.
What factors affect MT-ATP8 stability in the mitochondrial membrane?
The stability of MT-ATP8 in the mitochondrial membrane depends on proper assembly with other ATP synthase components. Research with peripheral stalk mutants (Δatp4 and Δatp14) showed decreased labeling of ATP8p, suggesting enhanced turnover rather than reduced translation . This indicates that proper integration into the ATP synthase complex is crucial for MT-ATP8 stability.
When ATP8 was replaced with ARG8m in these peripheral stalk mutants, expression of ARG8m was not significantly affected, confirming that the decreased ATP8p levels resulted from protein turnover rather than translational inhibition . These findings highlight the importance of protein-protein interactions for the stability of MT-ATP8 in the membrane environment.
What expression systems are used for recombinant horse MT-ATP8 production?
Recombinant horse MT-ATP8 is primarily produced using E. coli expression systems . The typical approach involves expressing the full-length protein (1-67 amino acids) with an N-terminal His-tag for purification purposes . The purified protein generally achieves greater than 90% purity as determined by SDS-PAGE .
Alternative expression systems include yeast, which can provide certain advantages for eukaryotic protein expression. The yeast system integrates benefits of mammalian cell expression while being more economical and efficient . This system can incorporate post-translational modifications such as glycosylation, acylation, and phosphorylation that may be important for native protein conformation .
What are the recommended storage and handling conditions for recombinant MT-ATP8?
Based on manufacturer recommendations, proper handling and storage of recombinant horse MT-ATP8 includes:
| Parameter | Recommendation |
|---|---|
| Storage temperature | -20°C/-80°C upon receipt |
| Working storage | 4°C for up to one week |
| Form | Typically lyophilized powder |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL |
| Long-term storage | Add 5-50% glycerol and aliquot |
| Buffer composition | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Stability note | Avoid repeated freeze-thaw cycles |
Proper reconstitution involves briefly centrifuging the vial prior to opening to bring contents to the bottom . These handling procedures help maintain protein stability and activity for research applications.
How does MT-ATP8 variation impact athletic performance in horses?
Evidence suggests that MT-ATP8 sequence variations may influence athletic performance in horses, particularly in disciplines requiring high aerobic capacity such as show jumping. Key research findings include:
-
Holstein horses bred for show jumping show high density of non-synonymous substitutions in ATP8, suggesting possible positive selection
-
The upward movement during jumping is highly energy-demanding, relying particularly on aerobic capacity
-
Studies have identified distinct maternal lineages in horses with different mitochondrial haplotypes that could be assigned to different haplogroups
-
Aerobic energy production takes place in mitochondria, making mitochondrial gene variation potentially important for athletic performance
A study investigating the influence of mitochondrial variation on Holstein mare performance found considerable molecular variation among mitochondrial genomes of different maternal lineages . Within a lineage, identical mtDNA haplotypes were found in all mares with respect to non-synonymous substitutions . This suggests that maternal lineage-specific MT-ATP8 variants could contribute to inheritable differences in energy metabolism efficiency and athletic capability.
What experimental approaches are most effective for studying MT-ATP8 function?
Several methodological approaches are effective for studying MT-ATP8 function:
-
Gene replacement studies: Replacing MT-ATP8 with reporter genes like ARG8m to monitor expression and regulation without affecting native function
-
In vivo labeling: Using radiolabeling to track newly synthesized MT-ATP8 and measure translational efficiency in different genetic backgrounds
-
Mutational analysis: Studying the effects of F1 mutants and assembly chaperone mutants on MT-ATP8 expression and ATP synthase assembly
-
High-copy suppression: Testing genes like ATP22 for their ability to rescue MT-ATP8 expression defects
-
Comparative genomics: Analyzing MT-ATP8 sequence variation across breeds and correlating with performance metrics
-
Mitochondrial function assays: Measuring ATP production, oxygen consumption, and energy metabolism in samples with different MT-ATP8 variants
These approaches can help elucidate the role of MT-ATP8 in ATP synthase function and its potential contribution to phenotypic differences in energy metabolism and performance.
How can MT-ATP8 be used in evolutionary and phylogenetic studies?
MT-ATP8 has proven valuable for evolutionary and phylogenetic analyses due to its high variability compared to other mitochondrial genes. Research has utilized MT-ATP8 sequences to:
-
Define major horse haplogroups (A-R) with diagnostic mutational motifs in both coding and control regions
-
Estimate divergence times using molecular clock approaches, with the horse-donkey split calibrated at approximately 2 million years ago
-
Trace maternal lineages and investigate domestication patterns in horses
-
Analyze selection pressures on mitochondrial genes by examining synonymous versus non-synonymous substitution rates
In a study of horse mitochondrial genomes, researchers brought the horse mtDNA phylogeny to high molecular resolution by analyzing 83 mitochondrial genomes from horses across Asia, Europe, the Middle East, and the Americas . This approach revealed that a wide range of matrilineal lineages from extinct Equus ferus underwent domestication in the Eurasian steppes during the Eneolithic period .
What challenges exist in functional characterization of recombinant MT-ATP8?
Functional characterization of recombinant MT-ATP8 presents several challenges:
-
Small size: At only 67 amino acids in horses, MT-ATP8 is challenging to work with independently
-
Membrane protein: Its hydrophobic nature complicates expression, purification, and functional studies
-
Complex integration: MT-ATP8 normally functions as part of the multisubunit ATP synthase complex, making isolated functional studies difficult
-
Coordination with ATP6: MT-ATP8 works in close association with ATP6, and their functions may be interdependent
-
Translation regulation: The complex translational regulation by F1 components adds another layer of complexity to expression studies
To overcome these challenges, researchers have developed approaches such as using reporter gene constructs (ARG8m), studying translation in different genetic backgrounds, and examining the effects of high-copy suppressors like ATP22 . These methods have helped elucidate the role of MT-ATP8 in ATP synthase biogenesis and function despite the technical difficulties associated with this small membrane protein.
