Recombinant Horse ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Equus caballus (Horse)
Target Names
Target Protein Sequence
MNENLFASFATPTMVGLPIVILIIMFPSILFPSPNRLINNRLISIQQWLVQLTSKQMMAI HNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVFMGFRHK TKAALAHFLPQGTPIFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGGATLA LMSISPSTALITFIILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. Subunit a is a key component of the proton channel, potentially playing a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the normal function of MT-ATP6 in equine mitochondria?

MT-ATP6 provides critical information for synthesizing a protein essential for normal mitochondrial function in horses. It forms one subunit of ATP synthase (Complex V), which is responsible for the final step of oxidative phosphorylation. This enzyme contains specialized segments that allow protons to flow across the inner mitochondrial membrane, using the energy created by this proton flow to convert adenosine diphosphate (ADP) to adenosine triphosphate (ATP), the cell's primary energy source . In horses specifically, the MT-ATP6 gene has been extensively studied for its role in energy production processes that contribute to characteristics associated with speed and force, which directly influence racing performance efficiency .

How does recombinant horse MT-ATP6 differ from naturally occurring forms?

Recombinant horse MT-ATP6 maintains the same amino acid sequence as the mature native protein but lacks post-translational modifications that occur in vivo. When expressing recombinant MT-ATP6, researchers must carefully consider the mitochondrial targeting peptide sequence, as horses possess several isoforms of ATP synthase subunits similar to other mammals. These isoforms differ primarily in their cleavable mitochondrial targeting peptides while sharing identical mature peptides . For experimental purposes, recombinant systems must include appropriate leader sequences to ensure proper folding and integration into functional complexes when studying reconstituted ATP synthase activity.

What is the genomic organization of horse MT-ATP6?

The horse MT-ATP6 gene is encoded in the maternally inherited mitochondrial genome. Research on Arabian and non-Arabian horses has identified multiple polymorphic sites within the gene. A comprehensive study that sequenced the ATP6 gene from 46 horse samples found seven variable nucleotide positions resulting in 9 distinct haplotypes . The gene shows an evolutionary pattern typical of mitochondrial genes, with a higher rate of transitions (6) compared to transversions (1) observed in these horse populations . The complete gene sequence provides essential data for phylogenetic analysis and comparative studies between different horse breeds.

What genetic diversity exists in horse MT-ATP6 across different breeds?

Studies examining MT-ATP6 in different horse breeds have revealed significant genetic diversity. Analysis of Arabian and Thoroughbred horses identified 6 polymorphic sites leading to 7 different haplotypes (GenBank accession numbers KX377925-KX377931) . A separate study focusing on Middle Eastern Arabian, Western Arabian, mixed Arabians, and non-Arabian horses found even greater diversity with 9 haplotypes and 99 nucleotide base substitutions with 7 variable positions . The observed haplotype diversity was calculated at 0.8141 with an average evolutionary divergence of 0.007 across all sequence pairs . This genetic diversity provides valuable markers for tracking maternal lineages and understanding the evolutionary history of modern horse populations.

How can MT-ATP6 polymorphisms be used to trace horse lineages?

MT-ATP6 polymorphisms serve as excellent markers for tracing maternal lineages in horses due to the maternal inheritance pattern of mitochondrial DNA. Researchers construct neighbor-joining phylogenetic trees using MT-ATP6 sequence data to establish relationships between different horse populations. In studies with Arabian and Thoroughbred horses, genetic analysis of the ATP6 gene has successfully demonstrated the affinities of tested animals to the Equus caballus subspecies . The identification of breed-specific haplotypes enables researchers to trace maternal ancestry and verify pedigrees, providing a molecular tool that complements traditional breeding records. For optimal lineage analysis, researchers should sequence at least 340-bp fragments of the gene to capture the most informative polymorphic sites .

What evolutionary insights can be gained from comparative analysis of MT-ATP6 across equids?

Comparative analysis of MT-ATP6 sequences across different equid species provides insight into evolutionary relationships and selective pressures. The genetic variations observed in the ATP6 gene reflect adaptations related to energy metabolism that may correlate with specific physiological traits. Research indicates that Arabian horse breeds show particularly high diversity, suggesting their ancient origin and potentially diverse founding population . When conducting cross-species analyses, researchers should focus on conserved functional domains versus regions with higher mutation rates. This approach helps identify sites under positive selection that may confer adaptations related to endurance, strength, or other performance traits in specific horse populations.

What are the optimal protocols for recombinant expression of horse MT-ATP6?

For optimal recombinant expression of horse MT-ATP6, researchers should consider using specialized expression systems that account for the protein's hydrophobic nature and mitochondrial origin. Based on protocols established for other ATP synthase subunits, a methodology combining bacterial expression systems with appropriate solubilization techniques is recommended. Expression vectors should be designed to include proper targeting sequences, as research has shown that the F1F0-ATP synthase has three isoforms (P1, P2, and P3) that differ by their cleavable mitochondrial targeting peptides . For functional studies, co-expression with other ATP synthase subunits may be necessary to achieve proper folding and activity. Purification typically involves nickel-affinity chromatography followed by size exclusion chromatography under conditions that maintain protein stability.

What methods are most effective for analyzing MT-ATP6 genetic variations in horse populations?

For analyzing MT-ATP6 genetic variations in horse populations, a combination of PCR amplification and DNA sequencing offers the most comprehensive approach. Based on published research, primers designed to amplify 340-bp fragments from the ATP6 gene have successfully identified polymorphic sites in horse populations . The sequencing data should be analyzed for single nucleotide polymorphisms (SNPs), with particular attention to both transitions and transversions. Construction of neighbor-joining trees using these sequences, along with reference sequences, can effectively establish genetic relationships within and between populations . For large-scale studies, next-generation sequencing approaches allow for high-throughput analysis of multiple samples simultaneously, enabling more comprehensive population genetics studies.

How can researchers effectively measure ATP synthase activity in studies involving recombinant horse MT-ATP6?

To effectively measure ATP synthase activity involving recombinant horse MT-ATP6, researchers should employ both ATP synthesis and hydrolysis assays. For ATP synthesis, an established method involves generating a proton motive force (pmf) with either NADH or succinate in the presence of ADP and phosphate, with ATP production measured using luminescence-based ATP detection kits . ATP hydrolysis can be measured by tracking inorganic phosphate release or through coupled enzyme assays. When evaluating recombinant MT-ATP6, it's crucial to verify its incorporation into the complete ATP synthase complex. Control experiments should include known inhibitors like oligomycin, which abolishes both synthesis and hydrolysis activities, and uncoupling agents like carbonyl cyanide 4-(trifluoromethoxy)-phenylhydrazone, which specifically inhibits ATP synthesis .

How does RNA binding influence the import and function of ATP synthase subunits in equine cells?

Recent research has revealed that RNA binding plays a significant role in the mitochondrial import of ATP synthase subunits. Studies demonstrated that F1-ATPase subunits can bind RNA, and this association appears to facilitate protein import into mitochondria . In vitro protein import assays with isolated mitochondria showed that treatment with RNase significantly reduced import rates of ATP5A1 (ATP synthase alpha subunit), while not affecting other mitochondrial proteins . For horse MT-ATP6 research, investigators should consider the potential role of RNA interactions in the import and assembly process. This emerging area suggests that RNA may serve as a chaperone or regulatory factor in ATP synthase biogenesis. When designing recombinant expression systems for horse MT-ATP6, preserving RNA-binding domains may be crucial for proper targeting and assembly.

What is the relationship between MT-ATP6 genetic variants and performance traits in horse breeds?

MT-ATP6 genetic variants have been associated with performance traits in horse breeds, particularly those related to energy metabolism. Research indicates that genetic variations in mitochondrial genes like ATP6 and ND2 have "highly significant effect and play important roles in different characteristics associated with speed and force which constitute race performance efficiency" . A comparative study examining Arabian and Thoroughbred horses found distinct haplotype patterns that may correlate with the notable endurance of Arabian breeds . To establish clear associations, researchers should implement comprehensive phenotyping protocols alongside genotyping, using standardized performance metrics such as VO₂ max, lactate threshold, and recovery rates. Statistical approaches like genome-wide association studies can then identify significant correlations between specific MT-ATP6 variants and performance parameters.

What are the common challenges in expressing functional recombinant horse MT-ATP6?

Expressing functional recombinant horse MT-ATP6 presents several challenges due to its hydrophobic nature and requirement for proper integration into the ATP synthase complex. Common difficulties include protein misfolding, aggregation, and low yield when expressed in isolation. Researchers have found that co-expression with other ATP synthase subunits improves proper folding and assembly . The choice of expression system is critical—bacterial systems often require fusion tags and specialized solubilization methods, while eukaryotic systems may better preserve native conformation but yield lower quantities. Another significant challenge is ensuring that the recombinant protein retains its interaction with inhibitor proteins like IF1, which selectively inhibits ATP hydrolysis without affecting ATP synthesis . Successful expression strategies typically involve optimizing codon usage for the host system and carefully selecting detergents for membrane protein solubilization.

How can researchers address data inconsistencies when analyzing MT-ATP6 sequence variations?

When analyzing MT-ATP6 sequence variations, researchers may encounter data inconsistencies due to heteroplasmy (multiple mitochondrial genome variants within the same individual), sequencing errors, or sample contamination. To address these challenges, implement rigorous quality control measures including bidirectional sequencing and appropriate coverage depth. For heteroplasmy detection, next-generation sequencing with high read depth provides more accurate quantification than traditional Sanger sequencing. When comparing datasets across studies, standardize the reference sequence and genomic coordinates to ensure consistent variant reporting. In horse population studies, discrepancies may arise from breed classification differences or admixture—researchers should clearly define breed criteria and consider genetic background testing using nuclear markers. For validation of critical variants, employ secondary methods such as restriction fragment length polymorphism (RFLP) analysis or allele-specific PCR.

What considerations are important when designing inhibitor studies for recombinant horse ATP synthase?

When designing inhibitor studies for recombinant horse ATP synthase, researchers must consider several key factors to ensure reliable results. First, the inhibitor's specificity for ATP synthase versus other ATPases should be verified, as many inhibitors can affect multiple targets. Based on established protocols, researchers should test inhibitors at multiple concentrations to generate dose-response curves, as seen with studies using bovine and human IF1 proteins . It's essential to separately assess effects on both ATP synthesis and hydrolysis, as certain inhibitors like IF1 selectively inhibit hydrolysis while leaving synthesis unaffected . The experimental system must maintain the proton motive force when testing synthesis inhibition, which can be verified using uncouplers like carbonyl cyanide 4-(trifluoromethoxy)-phenylhydrazone as controls . For accurate quantification of inhibition, researchers should employ established methods for assaying ATP, such as luminescence-based detection systems that provide real-time measurements .

Table 1: Polymorphic Sites in Horse MT-ATP6 Gene Across Different Breeds

Horse BreedNumber of SamplesPolymorphic SitesHaplotypesTransitionsTransversionsReference
Arabian and Thoroughbred2467Not specifiedNot specifiedMahrous et al., 2017
Middle Eastern Arabian, Western Arabian, hybrid Arabians and non-Arabians467961Comparative Analysis, 2018

Table 2: Genetic Diversity Metrics for MT-ATP6 in Horse Populations

PopulationHaplotype DiversityAverage Evolutionary DivergenceSNPs IdentifiedReference
Arabian and Thoroughbred horsesNot specifiedNot specifiedNot specifiedMahrous et al., 2017
Mixed Arabian and non-Arabian breeds0.81410.0074Comparative Analysis, 2018

Table 3: Inhibitor Effects on ATP Synthase Activity

InhibitorEffect on ATP HydrolysisEffect on ATP SynthesisMechanismReference
Bovine IF1Strong inhibitionNo significant inhibitionBinds to F1 domain during hydrolysisMontgomery et al., 2024
Human IF1Strong inhibitionNo significant inhibitionSimilar to bovine IF1Montgomery et al., 2024
OligomycinStrong inhibitionStrong inhibitionBinds to F0 domainMontgomery et al., 2024

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.