Recombinant Horse Complement component C9 (C9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Horse Complement Component C9 (C9)

Complement component 9 (C9) is a crucial protein in the complement system, specifically the terminal pathway that leads to the formation of the membrane attack complex (MAC) . The MAC is responsible for disrupting the cell membrane of target cells, leading to cell lysis . Horse C9 shares significant structural similarity with human C9, displaying around 77% identity in amino acid sequences . Despite these similarities, horse C9 exhibits limited hemolytic activity against mammalian erythrocytes, setting it apart from its human counterpart .

Structure and Composition

Horse C9 is composed of 526 amino acids and has a molecular weight of approximately 65 kDa . The protein contains 22 cysteine residues and four conserved tryptophan residues, mirroring the domain structure of human C9 . Unlike human C9, which has pyroglutamine at its N-terminus, horse C9 features an unblocked glycine . Additionally, horse C9 has three potential N-glycosylation sites, while human C9 has two . Research has identified that C9 can bind up to two calcium ions, which influences its structure and function within the MAC .

Functional Properties

C9 is integral to the formation of the MAC, which is a pore-like structure inserted into the cell membrane, leading to cell lysis . Specifically, C9 binds to the C5b-8 complex on the cell surface and polymerizes to create transmembrane channels . Studies suggest that the ratio of C9 to C8 determines the size of these channels . While horse C9 shows poor hemolytic activity, it is effective in killing Gram-negative bacteria .

Research Findings

  • Primary Structure Analysis: Sequencing of horse C9 cDNA has revealed a high degree of similarity to human C9, with a 77% identity in amino acid sequences .

  • Cytotoxic Activity: Although horse C9 has low hemolytic activity, it exhibits efficient cytotoxic activity against Gram-negative bacteria . This suggests that the mechanism of cell lysis may differ between erythrocytes and bacteria.

  • Chimeric Studies: Experiments involving chimeric horse/human C9 proteins have pinpointed a specific region responsible for restricting hemolysis in horse C9 . Exchanging a fragment from residues 145 to 290 between horse and human C9 can alter the hemolytic activity .

  • Membrane Attack Complex (MAC) Formation: C9 is essential for the formation of the MAC, and its ability to polymerize is critical for creating the pore structure . Ultrastructural studies have shown that the formation of ring-like membrane lesions is entirely dependent on C9 .

  • Glycosylation Analysis: Glycosylation patterns in C9 have been extensively studied, revealing the presence of both N- and O-linked glycans . These glycosylations may play a role in protein folding, stability, and interactions with other molecules .

Tables of Data

PropertyHorse C9Human C9
Number of Amino Acids526526
Sequence Identity77% identical to human C9 77% identical to horse C9
N-terminusUnblocked Glycine Pyroglutamine
N-glycosylation Sites3 2
Hemolytic ActivityLow High
Activity Against BacteriaEfficient

Potential Applications

Given its cytotoxic activity against Gram-negative bacteria, recombinant horse C9 could be explored for its potential in developing new antibacterial therapies . Understanding the structural differences and functional properties of horse C9 compared to human C9 may provide insights into complement-mediated diseases and potential therapeutic interventions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C9; Complement component C9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-547
Protein Length
Full Length of Mature Protein
Species
Equus caballus (Horse)
Target Names
C9
Target Protein Sequence
GPTPNYAPEPEQQSGTPLPIDCRMSSWSEWSECDPCLRQMFRSRSIEVFGQFNGQRCVDA VGDRRQCVPTEACEEVEDDCGNDFQCGTGRCIKKRLLCNGDNDCGDFSDEDDCENDPRPP CRERVVEESELARTAGYGINILGMDPLSTPFDNEYYNGLCDRVRDGNTLTYYRKPWNLAS LAYETKADKNFRIEHYEQQIQAFRSVIEERRSHFNADFTLKFTPTEAKKCKQEPEESCNG TDSSENRIFRFAYSKNETYQLFLSYSSKKEKMFLHVKGVIQLGKFVMRSRDVVLTTTFLD DIKALPTAYEKGEYIAFLETYGTHYSSSGSLGGLYELIYVLDKASMDQKGVELRDIQRCL GFNLDLSLKDKYEVTAKIDKNDCLKRNEKEIVNIMDGSLIDDVISLIRGGTRKYAFELKE KLLKGAKTVNVTDFVNWASSLNDAPVLISQRLSPIYNLIPVKMKDAHQKKQNLERAIEDY INEFSVRKCHPCQNGGTVIQIDGQCLCSCPIAFEGIACETGKKKIS
Uniprot No.

Target Background

Function

Recombinant Horse Complement component C9 (C9): A key component of the membrane attack complex (MAC), integral to both innate and adaptive immune responses. C9 forms pores in the plasma membranes of target cells, mediating their lysis.

Database Links
Protein Families
Complement C6/C7/C8/C9 family
Subcellular Location
Secreted. Target cell membrane; Multi-pass membrane protein.

Q&A

What is horse complement component C9 and how does it differ structurally from human C9?

Horse complement component C9 is the terminal protein in the complement cascade that contributes to the formation of the membrane attack complex (MAC). The mature horse C9 protein consists of 526 amino acids and shares 77% sequence identity with human C9 . Despite this high sequence similarity, there are several notable structural differences:

  • Horse C9 has an unblocked glycine at the N-terminus, whereas human C9 has pyroglutamine

  • Horse C9 possesses three potential N-glycosylation sites compared to two in human C9

  • Both proteins contain 22 cysteines and four invariant tryptophans

  • Both maintain the same domain structure, with highly conserved regions between positions 250 and 360, which includes the membrane interaction domain and postulated transmembrane segment

These structural similarities coupled with functional differences make horse C9 a fascinating model for studying complement system evolution and species-specific immune mechanisms.

Why does horse C9 exhibit significantly lower hemolytic activity compared to human C9?

The markedly reduced hemolytic activity of horse C9 against mammalian erythrocytes is an inherent property of the protein rather than a deficiency in its expression or structure . Research suggests this restriction is related to specific interactions between horse C9 and membrane-bound regulatory proteins on target cells. Key findings that explain this phenomenon include:

  • The hinge region (residues 145-290) appears to be the critical determinant of hemolytic activity, as demonstrated by chimeric horse/human C9 studies

  • This region interacts with erythrocyte restriction factors such as glycophorin, CD59, or homologous restriction factor

  • Direct binding of CD59 to immobilized horse C9 has been detected by ligand blotting

  • When CD59 is inhibited by polyclonal anti-CD59 antibodies, horse C9-mediated hemolysis increases, though not to the level achieved by inserting the human C9 hinge region into horse C9

This suggests that while horse C9 is structurally competent, its hemolytic activity is regulated through specific interactions with membrane control proteins, particularly involving the hinge region.

What are the optimal expression systems for producing recombinant horse C9 with native-like properties?

Producing functional recombinant horse C9 requires careful consideration of expression systems that can accommodate the protein's complex structure with proper folding and post-translational modifications. Based on published research methodologies:

  • COS-7 cells have been successfully employed for expressing both native horse C9 and chimeric horse/human C9 proteins that retain their characteristic activity profiles

  • The expression system must support proper formation of multiple disulfide bonds (horse C9 contains 22 cysteines)

  • Glycosylation capability is essential, as horse C9 contains three potential N-glycosylation sites

  • Purification strategies typically employ affinity chromatography followed by functional verification

When designing expression systems for recombinant horse C9, researchers should consider the following parameters:

Expression ParameterRecommended ApproachRationale
Cell lineMammalian (COS-7, HEK293)Proper post-translational modifications
Expression vectorCMV promoter-basedHigh expression levels
Purification tagC-terminal tag preferredMinimizes interference with N-terminal function
VerificationHemolytic assay, bacterial killingConfirms proper folding and function

These considerations ensure production of recombinant horse C9 that accurately reflects the native protein's structure and functional characteristics.

How can chimeric horse/human C9 proteins be designed to investigate specific functional domains?

Chimeric horse/human C9 proteins have proven invaluable for mapping functional domains and understanding the molecular basis of species-specific activities. The methodology for creating and analyzing such chimeric proteins includes:

  • Identification of domain boundaries based on sequence alignment and structural predictions

  • Strategic design of chimeric constructs that exchange specific domains between horse and human C9

  • Expression in mammalian cells (typically COS-7) to ensure proper folding and post-translational modifications

  • Functional testing through hemolytic assays and bacterial killing assays

  • Binding studies to identify interactions with regulatory proteins

Previous research successfully identified the hinge region (residues 145-290) as critical for hemolytic activity by exchanging this fragment between horse and human C9 . Similar approaches can be employed to investigate other domains:

  • The membrane-interacting domain (part of the region between positions 250-360)

  • The N-terminal thrombospondin type 1 repeat (TSR) domain

  • The low-density lipoprotein receptor class A (LDLRA) domain

  • The epidermal growth factor-like (EGF) domains

This domain-swapping approach, combined with functional assays, continues to be a powerful method for investigating structure-function relationships in complement proteins.

What analytical techniques are most effective for studying the membrane insertion mechanism of horse C9?

Investigating the membrane insertion mechanism of horse C9, particularly in comparison to human C9, requires sophisticated analytical techniques. Recommended approaches include:

  • Photoactivatable membrane-restricted probes to map membrane penetration depth

  • Fluorescence resonance energy transfer (FRET) to study conformational changes during insertion

  • Electron microscopy to visualize MAC formation with horse versus human C9

  • Hydrogen-deuterium exchange mass spectrometry to identify regions exposed during membrane interaction

  • Surface plasmon resonance to measure binding kinetics to C5b-8 complexes and membrane components

Research has shown that C9 within the membrane-bound MAC extends from the hydrophilic phase into the hydrocarbon phase of the membrane . The reduced hemolytic activity of horse C9 suggests altered insertion dynamics that can be studied using these techniques.

Comparative studies between horse and human C9, particularly focusing on the putative hinge region (residues 145-290), can provide insights into how structural differences impact the membrane insertion process and interaction with regulatory proteins like CD59.

How can horse C9 be utilized as a model for studying complement evasion by pathogens?

Horse C9's unique profile of reduced hemolytic activity but maintained bactericidal function makes it an excellent model for studying pathogen complement evasion strategies. Research approaches should consider:

  • Comparative susceptibility of various bacterial strains to horse versus human C9

  • Identification of bacterial factors that confer resistance specifically to horse C9

  • Analysis of how bacterial membrane composition affects susceptibility to horse C9

  • Investigation of whether bacterial pathogens of horses have evolved specific mechanisms to evade horse C9-mediated killing

These studies can provide insights into host-pathogen co-evolution and species-specific immune evasion mechanisms. Understanding how bacteria may differentially resist horse versus human C9 could reveal novel targets for antimicrobial development.

What experimental controls are essential when studying the interaction between horse C9 and regulatory proteins?

When investigating interactions between horse C9 and regulatory proteins such as CD59, careful experimental design with appropriate controls is critical. Essential controls and considerations include:

  • Parallel testing of human and horse C9 under identical conditions to establish baseline differences

  • Inclusion of bovine C9 (which has an identical N-terminus to horse C9 but retains strong hemolytic activity) as a control

  • Pre-treatment of target cells with antibodies against specific regulatory proteins (e.g., anti-CD59)

  • Use of cells from different species with varying susceptibility to horse C9-mediated lysis

  • Employment of chimeric horse/human C9 proteins with defined domain swaps as functional controls

These controls help distinguish between effects mediated by structural differences in C9 itself versus those resulting from interactions with regulatory proteins on target cells.

How can contradictory findings regarding the role of the hinge region versus other domains in horse C9 function be reconciled?

Research on horse C9 has yielded some apparently contradictory findings regarding the relative importance of different domains in determining functional specificity. To reconcile these contradictions, researchers should consider:

  • The hinge region (residues 145-290) has been identified as critical for hemolytic activity, yet the membrane interaction domain (within positions 250-360) is highly conserved between horse and human C9

  • Horse C9 maintains bactericidal activity despite reduced hemolytic function, suggesting target-specific mechanisms beyond simple structural differences

  • CD59 binding to horse C9 has been demonstrated, yet inhibition of CD59 does not fully restore hemolytic activity to the level achieved by chimeric proteins with the human hinge region

A comprehensive experimental approach that addresses these apparent contradictions would include:

  • Creation of a more extensive series of chimeric proteins with smaller domain swaps

  • Detailed binding studies with purified regulatory proteins from multiple species

  • Structural studies (X-ray crystallography, cryo-EM) of horse C9 in different conformational states

  • Molecular dynamics simulations to model the interaction between horse C9 and various membranes

This multifaceted approach would help resolve current contradictions and provide a more nuanced understanding of horse C9's structure-function relationships.

How might CRISPR/Cas9 genome editing be applied to further understand horse C9 function in vivo?

CRISPR/Cas9 genome editing offers powerful new approaches for studying horse C9 function that were previously impossible. Potential applications include:

  • Introduction of human C9 hinge region sequences into the horse genome to create knock-in models with altered hemolytic function

  • Generation of horse cell lines with modified regulatory proteins (CD59, glycophorin) to study their interaction with C9

  • Creation of humanized horse C9 models to investigate species-specific complement functions

  • Introduction of reporter tags into endogenous horse C9 to track its expression and localization in vivo

These genome editing approaches could provide unprecedented insights into the evolutionary significance of horse C9's restricted hemolytic activity and its role in equine immune function.

What are the implications of horse C9's unique properties for developing novel therapeutic strategies targeting the complement system?

Horse C9's distinctive profile of reduced hemolytic activity while maintaining bactericidal function suggests potential applications in therapeutic development:

  • Design of complement-based antimicrobials that selectively target pathogens while sparing host cells

  • Development of recombinant C9 variants with engineered specificity profiles

  • Creation of inhibitors that mimic the regulatory interactions between horse C9 and proteins like CD59

  • Exploration of species-specific complement components as models for targeted complement therapeutics

Understanding the molecular basis of horse C9's selective cytotoxicity could inform the design of complement-based therapeutics with improved safety profiles by minimizing unintended damage to host tissues.

How can structural biology techniques advance our understanding of the conformational changes in horse C9 during MAC formation?

Advanced structural biology techniques offer new opportunities to visualize and understand the conformational dynamics of horse C9 during MAC formation. Promising approaches include:

  • Cryo-electron microscopy to visualize the complete MAC structure with horse versus human C9

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during assembly

  • Single-molecule FRET to track real-time conformational dynamics during insertion

  • X-ray crystallography of horse C9 in different states (soluble, membrane-bound)

  • Molecular dynamics simulations to model the energetics of membrane insertion

These techniques could reveal how subtle structural differences between horse and human C9, particularly in the hinge region, translate into significant functional differences in membrane insertion and cytolytic activity.

What are the optimal assay systems for accurately measuring horse C9 hemolytic activity?

Designing reliable assays to measure horse C9 hemolytic activity requires careful consideration of several factors:

  • Selection of appropriate erythrocyte targets (horse C9 shows variable activity against erythrocytes from different species)

  • Preparation of standardized EAC1-8 cells (erythrocytes with pre-assembled C5b-8 complexes)

  • Careful temperature control (C9-mediated hemolysis is temperature-sensitive)

  • Inclusion of positive controls (human C9) and negative controls

  • Consideration of incubation time (horse C9-mediated hemolysis may proceed more slowly)

A standardized protocol might include:

  • Preparation of sheep erythrocytes sensitized with antibody and complement components C1-C8

  • Addition of purified or recombinant horse C9 at various concentrations

  • Incubation at 37°C for extended periods (monitoring at multiple time points)

  • Measurement of hemolysis by spectrophotometric detection of released hemoglobin

  • Parallel testing with human C9 for comparison

This approach allows for accurate quantification of horse C9's hemolytic activity and comparison with human C9 or chimeric variants.

What purification strategies yield the highest quality recombinant horse C9 for functional studies?

Obtaining high-quality purified recombinant horse C9 is essential for reliable functional studies. Recommended purification strategies include:

  • Expression in mammalian cell systems (COS-7, HEK293) to ensure proper folding and post-translational modifications

  • Inclusion of appropriate secretion signals for efficient extracellular release

  • Use of affinity tags that minimally impact protein function

  • Multi-step purification protocols combining affinity chromatography with ion exchange and size exclusion steps

  • Verification of proper folding through circular dichroism and functional assays

A typical purification workflow might include:

  • Collection of conditioned media from transfected cells

  • Initial capture using affinity chromatography (His-tag, FLAG-tag)

  • Secondary purification by ion exchange chromatography

  • Final polishing using size exclusion chromatography

  • Quality control by SDS-PAGE, Western blotting, and functional testing

This approach yields highly purified recombinant horse C9 suitable for detailed functional and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.