Recombinant Horse Cytochrome b5 (CYB5A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYB5A; CYB5; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-134
Protein Length
Full Length of Mature Protein
Species
Equus caballus (Horse)
Target Names
CYB5A
Target Protein Sequence
AEQSDKAVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEDHPGGEEVLREQAGGDATE NFEDIGHSTDARELSKTFIIGELHPDDRSKIAKPVETLITTVDSNSSWWTNWVIPAISAV VVALMYRIYTAED
Uniprot No.

Target Background

Function
Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for several membrane-bound oxygenases.
Database Links

UniGene: Eca.5688

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

Basic Research Questions

  • What is Horse Cytochrome b5 (CYB5A) and what are its basic structural features?

Horse CYB5A is a small heme-binding protein classified as "cytochrome b5 type A (microsomal)" with gene ID 100052210 . The protein structure features a characteristic fold with two hydrophobic cores separated by a five-stranded β-sheet, similar to other cytochrome b5 proteins . The heme in cytochrome b5 is typically ligated by the imidazolyl side chains of two histidine residues, specifically His89 and His112 in human Ncb5or-b5 (which shares structural similarities with horse CYB5A) .

Horse CYB5A contains the characteristic "HPGG" motif that is conserved in all known eukaryotic members of the cytochrome b5 superfamily . This motif includes a loop containing one of the histidine residues that serves as a heme ligand. The protein consists of several α-helical structures and β-sheet strands, with notable structural elements including core 1 (comprising helices α2-α5) which contains the heme-binding pocket.

Methodologically, researchers typically study the structure of CYB5A through X-ray crystallography, NMR spectroscopy, and comparative modeling with other species' cytochrome b5 proteins.

  • How is recombinant Horse CYB5A expressed and purified for research applications?

Recombinant Horse CYB5A can be expressed using standardized molecular biology techniques with the following methodological considerations:

Expression Systems:

  • The gene encoding horse CYB5A (NM_001159732.1) can be cloned into expression vectors such as pcDNA3.1+/C-(K)DYK or customized vectors

  • E. coli is commonly used as an expression host for cytochrome b5 proteins

  • For eukaryotic expression, systems like yeast, insect cells, or mammalian cells may be employed

Expression Construct Design:

  • Full-length construct: Contains complete coding sequence (405bp for horse CYB5A)

  • Soluble domain construct: Typically includes only the heme-binding domain without the C-terminal membrane anchor

  • Addition of purification tags (His-tag, GST, etc.) to facilitate purification

Purification Protocol:

  • Cell lysis by sonication or mechanical disruption

  • Initial clarification by centrifugation

  • Affinity chromatography (if tagged) or ion-exchange chromatography

  • Size-exclusion chromatography for final purification

  • Buffer conditions: Stability may require high salt concentrations similar to other cytochrome b5 proteins (e.g., 20 mM Tris-HCl, 500 mM NaCl, 0.1 mM EDTA, pH 7.0)

Quality Control Methods:

  • UV-visible spectroscopy to confirm proper heme incorporation

  • SDS-PAGE to assess protein purity

  • Mass spectrometry to confirm identity

  • Functional assays to verify electron transfer capabilities

The expression yield and protein stability should be carefully monitored, as some cytochrome b5 variants show tendencies toward loss of heme and protein aggregation during concentration .

  • What spectroscopic techniques are most useful for characterizing recombinant Horse CYB5A?

Several spectroscopic techniques provide valuable information about recombinant Horse CYB5A:

UV-Visible Spectroscopy:

  • Primary technique for characterizing heme-containing proteins

  • Oxidized cytochrome b5 shows a characteristic Soret band at approximately 413 nm

  • Reduced cytochrome b5 exhibits distinct peaks at around 423 nm (Soret), 526 nm (β-band), and 556 nm (α-band)

  • Changes in these spectral features indicate heme coordination state and environment

  • Useful for protein quantification using established extinction coefficients

NMR Spectroscopy:

  • Provides detailed structural information at atomic resolution

  • 1H-15N HSQC spectra map the protein backbone and monitor conformational changes

  • Cross-saturation transfer experiments can identify protein-protein interaction interfaces

  • Studies on cytochrome c and b5 interactions have used NMR to map binding interfaces and determine binding kinetics

Circular Dichroism (CD):

  • Monitors secondary structure content and folding

  • Far-UV CD (190-250 nm) for secondary structure analysis

  • Near-UV CD (250-350 nm) for tertiary structure fingerprinting

  • Thermal denaturation studies using CD can determine stability (Tm values)

Fluorescence Spectroscopy:

  • Intrinsic tryptophan/tyrosine fluorescence for tertiary structure analysis

  • Used to determine apoprotein (heme-free) concentration

  • Extinction coefficient of approximately 10.6 mM-1cm-1 at 280 nm for apocytochrome b5

  • Useful for monitoring unfolding transitions and ligand binding

These spectroscopic methods should be used in combination to thoroughly characterize recombinant Horse CYB5A structure, stability, and function in experimental settings.

Intermediate Research Questions

  • What experimental approaches can reveal the electron transfer mechanism between Horse CYB5A and partner proteins?

Investigating electron transfer mechanisms requires multiple complementary techniques:

Protein-Protein Interaction Analysis:

  • NMR spectroscopy: Cross-saturation transfer experiments with isotopically labeled proteins can map interaction interfaces

  • Chemical shift perturbation studies: Track changes in protein resonances upon complex formation

  • Studies with horse cytochrome c and bovine cytochrome b5 revealed binding with association constant (Ka) of (4 ± 3) × 105 M-1 and dissociation rate ≥855 s-1

Kinetic Studies:

  • Stopped-flow spectroscopy to measure electron transfer rates

  • Multi-wavelength analysis to track changes in redox states

  • Temperature-dependent studies to determine activation parameters

  • Comparison of electron transfer rates between different cytochrome b5 variants reveals differences in efficiency

Electrostatic Analysis:

  • Computational mapping of surface charge distribution

  • Analysis of bovine Cyb5A shows a high density of negative charge in core 1 (α2-α5) critical for interactions with positively charged regions in partner proteins

  • Horse CYB5A likely employs similar electrostatic interactions

Mutagenesis Approaches:

  • Site-directed mutagenesis of key residues at the binding interface

  • Analysis of how mutations affect electron transfer rates

  • Similar to studies on Ncb5or where R113A and W114A mutants were generated to study their roles in electron transfer

Structural Analysis of Complexes:

  • Protein docking using NMR constraints to generate model complexes

  • Calculation of the effects of heme ring current-induced magnetic dipoles to discriminate between different models

  • Modeling the orientation of redox centers and electron transfer pathways

These methodological approaches collectively provide insights into the electron transfer mechanism between Horse CYB5A and its physiological partners.

  • How do researchers distinguish between the structural and functional differences of Horse CYB5A compared to cytochrome b5 proteins from other species?

Distinguishing between horse CYB5A and other cytochrome b5 proteins requires systematic comparative analysis:

Sequence Analysis:

  • Multiple sequence alignment to identify conserved and variable regions

  • Identification of species-specific residues that may affect function

  • Analysis of conservation patterns in functional motifs (e.g., the "HPGG" motif)

Structural Comparison:

Heme Environment Analysis:

  • Spectroscopic comparison of heme coordination and electronic environment

  • Analysis of heme orientation isomer distribution, which varies significantly between species:

    • 9:1 (A:B) in bovine microsomal cytochrome b5

    • 20:1 in chicken microsomal cytochrome b5

    • 1.6:1 in rat microsomal cytochrome b5

    • 1:1 in rat outer mitochondrial membrane cytochrome b5

Stability Studies:

  • Comparative thermal denaturation experiments

  • Chemical denaturation profiles with denaturants like guanidinium hydrochloride

  • Analysis of factors affecting stability, such as heme binding affinity

Interaction Studies:

  • Comparative binding studies with partner proteins

  • Analysis of kinetic parameters for electron transfer

  • Studies show that interaction surfaces can differ between species, as demonstrated between horse cytochrome c and yeast cytochrome c interactions with cytochrome b5

Functional Assays:

  • Side-by-side comparison of electron transfer rates

  • Analysis of substrate specificity and partner protein preferences

  • Studies similar to those showing that cytochrome P450 3A related metabolism in horse depends on adequate levels of NADPH P450 reductase and cytochrome b5

These comparative approaches enable researchers to understand the species-specific characteristics of Horse CYB5A that may be relevant to its physiological function.

  • What techniques provide the most accurate measurements of heme binding affinity and stability in recombinant Horse CYB5A?

Accurate determination of heme binding affinity and stability requires rigorous methodological approaches:

Heme Binding Affinity Measurements:

  • Equilibrium Titration Methods:

    • Titration of apoprotein with increasing concentrations of heme

    • Monitoring spectral changes (UV-visible absorption, fluorescence)

    • Fitting data to appropriate binding models (one-site, cooperative, etc.)

    • Determining dissociation constants (Kd)

  • Kinetic Methods:

    • Stopped-flow spectroscopy to measure association rates (kon)

    • Heme transfer experiments to determine dissociation rates (koff)

    • The ratio koff/kon provides Kd values that can be compared with equilibrium measurements

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of heat changes during binding

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG)

    • Gold standard for binding affinity determination

  • Heme Dissociation Kinetics:

    • Measurement of first-order rate constants (k-h) for hemin transfer from cytochrome b5 to an acceptor protein like apomyoglobin

    • This approach has revealed that stability differences between cytochrome b5 variants correlate with rates of heme release

Stability Measurements:

These complementary approaches provide a comprehensive assessment of heme binding and stability properties of recombinant Horse CYB5A.

Advanced Research Questions

  • How can researchers design experiments to quantify electron transfer efficiency between Horse CYB5A and redox partners at the molecular level?

Quantifying electron transfer efficiency requires sophisticated experimental designs:

Steady-State Kinetic Analysis:

  • Spectrophotometric assays measuring reaction rates under varying conditions

  • Determination of steady-state parameters (Km, kcat, kcat/Km)

  • Comparison of kinetic parameters across different cytochrome b5 variants and partner proteins

  • Systematic analysis of factors affecting efficiency (pH, ionic strength, temperature)

Pre-Steady-State Kinetic Measurements:

  • Stopped-flow spectroscopy with rapid mixing (millisecond timescale)

  • Laser flash photolysis for ultrafast reactions (nanosecond to microsecond)

  • Freeze-quench methods coupled with EPR spectroscopy

  • Resolution of individual electron transfer steps in multi-component systems

  • Studies comparing electron transfer from Ncb5or-b5R to Ncb5or-b5 versus Cyb5R3 to Cyb5A have revealed efficiency differences attributed to electrostatic interactions

Electrochemical Approaches:

  • Protein film voltammetry for direct measurement of electron transfer

  • Cyclic voltammetry to determine redox potentials

  • Mediated electrochemistry for proteins that don't interact directly with electrodes

  • Determination of overpotential and reorganization energy

Structure-Based Analysis:

  • Measurement of distances between redox centers using structural data

  • Analysis of electron transfer pathways through the protein matrix

  • Marcus theory calculations to predict electron transfer rates based on:

    • Redox potential differences (ΔG°)

    • Reorganization energy (λ)

    • Electronic coupling (HAB)

Electrostatic Analysis:

  • Mapping of electrostatic potentials on protein surfaces

  • Correlation of electron transfer rates with electrostatic properties

  • Studies have shown that docking between cytochrome b5 and partner proteins involves electrostatic interactions between complementary charged regions

  • Comparative analysis of charge distribution can explain variations in electron transfer efficiency

Systematic Mutagenesis:

  • Generation of point mutations along potential electron transfer pathways

  • Creation of charge-altering mutations at binding interfaces

  • Mutations similar to the R113A and W114A variants created for Ncb5or-b5

  • Correlation of electron transfer rates with specific amino acid substitutions

These experimental approaches, when used in combination, provide a comprehensive quantitative understanding of electron transfer efficiency between Horse CYB5A and its redox partners.

  • What methods are effective for investigating the dynamics and functional significance of heme orientation isomers in Horse CYB5A?

Heme orientation isomers in cytochrome b5 proteins present unique research challenges that require specialized methods:

Spectroscopic Identification and Quantification:

  • NMR Spectroscopy:

    • High-resolution 1D and 2D NMR to distinguish isomers

    • Analysis of heme methyl resonances which differ between isomers

    • Quantitative integration of isomer-specific signals

    • Time-course experiments to monitor isomer interconversion

  • Resonance Raman Spectroscopy:

    • Identification of isomer-specific vibrational modes

    • Analysis of heme-protein interactions in different isomers

    • Correlation of spectral features with functional properties

  • EPR Spectroscopy:

    • Distinguishing isomers in the oxidized state through g-value differences

    • Analysis of the electronic environment around the heme

Kinetic Analysis of Isomer Interconversion:

  • Time-Resolved Spectroscopy:

    • Following changes in isomer ratios over time after reconstitution

    • Studies show that when apocytochromes b5 are reconstituted with hemin, the initial ~1:1 mixture gradually shifts to an equilibrium ratio characteristic of each protein variant

    • Determination of half-lives for isomer interconversion (e.g., half-life of 13 hours for isomer B to A conversion in bovine cytochrome b5 at pH 7.0, 24°C)

  • Temperature-Dependent Studies:

    • Arrhenius analysis to determine activation parameters for interconversion

    • Correlation of interconversion rates with protein stability

Functional Differences Between Isomers:

Factors Affecting Isomer Distribution:

  • Comparative Analysis:

    • Study of naturally occurring variants with different isomer ratios

    • Heme orientational disorder differs widely among cytochromes b5:

      • 9:1 (A:B) in bovine microsomal

      • 20:1 in chicken microsomal

      • 1.6:1 in rat microsomal

      • 1:1 in rat outer mitochondrial membrane

  • Mutagenesis Approaches:

    • Creation of point mutations near the heme pocket to alter isomer preference

    • Identification of residues that influence isomer stability and interconversion

  • Environmental Factors:

    • Analysis of pH, temperature, and ionic strength effects on isomer distribution

    • Investigation of protein concentration effects on isomer equilibrium

These methods collectively provide insights into the dynamics and functional significance of heme orientation isomers in Horse CYB5A, contributing to our understanding of structure-function relationships in this important electron transfer protein.

  • What mutagenesis strategies can researchers employ to map the functional domains and critical residues in Horse CYB5A?

Systematic mutagenesis of Horse CYB5A requires careful planning and strategic approaches:

Rational Design of Mutations:

  • Structure-Guided Selection:

    • Target residues in functional regions:

      • Heme-coordinating histidines (equivalent to His89 and His112 in Ncb5or-b5)

      • The conserved "HPGG" motif essential for heme binding

      • Surface residues in core 1 (α2-α5) involved in protein-protein interactions

      • Residues involved in electrostatic interactions with partner proteins

  • Sequence Conservation Analysis:

    • Target highly conserved residues across species

    • Investigate species-specific residues that might confer unique properties

    • Focus on the 11 invariant negatively charged residues (Glu and Asp) found in mammalian Cyb5A core 1

  • Charge Distribution Analysis:

    • Map surface electrostatics to identify charged patches

    • Target charged residues similar to studies showing that docking between cytochrome b5 and partners involves electrostatic interactions

Types of Mutations to Consider:

  • Alanine-Scanning Mutagenesis:

    • Systematic replacement of surface residues with alanine

    • Similar to the R113A and W114A mutants created for Ncb5or-b5

    • Alanine removes side chain interactions while maintaining backbone conformation

  • Charge Alterations:

    • Neutralization: Asp/Glu → Asn/Gln or Lys/Arg → Leu/Met

    • Charge reversal: Asp/Glu → Lys/Arg or vice versa

    • Particularly relevant for studying electrostatic interactions with partner proteins

  • Conservative Substitutions:

    • Minor changes that preserve chemical properties (e.g., Asp → Glu)

    • Useful for probing subtle structural effects

  • Non-Conservative Substitutions:

    • Major changes in residue properties

    • Tests tolerance of specific positions to substantial alteration

Functional Characterization of Mutants:

  • Structural Integrity:

    • Spectroscopic analysis (UV-visible, CD, NMR) to confirm proper folding

    • Thermal and chemical stability measurements

    • Comparison of heme binding properties with wild-type protein

  • Partner Protein Interactions:

    • Binding affinity measurements using ITC, SPR, or fluorescence

    • NMR chemical shift perturbation to map binding interfaces

    • Cross-linking studies to identify interaction sites

  • Electron Transfer Kinetics:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Comparison with wild-type to identify rate-limiting steps

    • Correlation of structural changes with functional effects

  • In Vitro Functional Assays:

    • Reconstitution with relevant enzymatic systems

    • Measurement of activity in coupled enzyme assays

    • Analysis similar to studies showing CYP3A metabolism in horse depends on cytochrome b5 levels

These mutagenesis strategies, combined with thorough functional characterization, allow researchers to map the structure-function relationships in Horse CYB5A at the molecular level.

  • What computational modeling approaches are most effective for predicting and analyzing Horse CYB5A interactions with physiological redox partners?

Computational modeling of Horse CYB5A interactions requires sophisticated methods:

Protein-Protein Docking:

  • Rigid-Body Docking:

    • Software: HADDOCK, ZDOCK, ClusPro, RosettaDock

    • Generation of multiple possible complex conformations

    • Scoring and ranking based on energetic and geometric criteria

    • Similar to approaches used to calculate model complex clusters for cytochrome c-cytochrome b5 interactions

  • Constraint-Driven Docking:

    • Incorporation of experimental constraints from:

      • NMR chemical shift perturbations

      • Mutagenesis data

      • Cross-linking experiments

    • This approach significantly improves accuracy of predicted complexes

    • NMR data has been successfully used as constraints for modeling cytochrome interactions

  • Flexible Docking:

    • Accounting for conformational changes upon binding

    • Ensemble docking using multiple starting conformations

    • Induced-fit protocols that allow local flexibility

Molecular Dynamics Simulations:

  • Complex Stability Analysis:

    • Simulation of docked complexes in explicit solvent

    • Analysis of interaction persistence over time

    • Identification of key residue contacts and water-mediated interactions

    • Calculation of binding free energies using methods like MM-PBSA or MM-GBSA

  • Enhanced Sampling Techniques:

    • Replica exchange MD to overcome energy barriers

    • Metadynamics to explore free energy landscapes

    • These methods provide insights into transient interactions and alternative binding modes

Specialized Calculations for Cytochrome Interactions:

  • Electrostatic Analysis:

    • Calculation of protein surface potentials

    • Visualization of complementary charged regions

    • Particularly important since studies show that cytochrome b5 interactions involve electrostatic complementarity

    • Poisson-Boltzmann calculations to quantify electrostatic contributions to binding

  • Heme Electronic Effects:

    • Calculation of heme ring current effects on partner proteins

    • This approach has been used to discriminate between different cytochrome complex models

    • Quantum mechanical calculations of heme electronic properties

  • Electron Transfer Pathway Analysis:

    • Identification of potential electron transfer pathways

    • Calculation of electronic coupling between redox centers

    • Prediction of electron transfer rates using Marcus theory

    • Correlation with experimental measurements

Brownian Dynamics Simulations:

  • Association Rate Calculations:

    • Prediction of protein-protein association rates (kon)

    • Mapping of encounter complex formation

    • Brownian dynamics has been used to predict interfaces in cytochrome interactions

  • Electrostatic Steering Analysis:

    • Quantification of long-range electrostatic effects

    • Understanding how charge distribution affects association kinetics

Integration with Experimental Data:

  • Model Validation:

    • Comparison of predicted interfaces with NMR chemical shift perturbations

    • Validation using mutagenesis data

    • Cross-correlation with electron transfer kinetics

  • Iterative Refinement:

    • Using experimental feedback to refine computational models

    • Generation of testable hypotheses for further experiments

These computational approaches, especially when integrated with experimental data, provide valuable insights into the molecular mechanisms of Horse CYB5A interactions with its physiological redox partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.