Recombinant Horse Glycophorin-A

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Glycophorin-A; Glycophorin-HA; CD antigen CD235a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Equus caballus (Horse)
Target Protein Sequence
QTIATGSPPIAGTSDLSTITSAATPTFTTEQDGREQGDGLQLAHDFSQPVITVIILGVMA GIIGIILLLAYVSRRLRKRPPADVPPPASTVPSADAPPPVSEDDETSLTSVETDYPGDSQ
Uniprot No.

Target Background

Function

Glycophorin A is the major intrinsic membrane sialoglycoprotein of erythrocytes. It plays a crucial role in SLC4A1 function and is essential for its high activity. It may also be involved in the translocation of SLC4A1 to the plasma membrane.

Protein Families
Glycophorin-A family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is horse glycophorin-A and how does it differ from human glycophorin-A?

Horse glycophorin-A is a major sialoglycoprotein found on equine erythrocyte membranes that shares functional similarity with human glycophorin-A but exhibits species-specific structural differences. Like its human counterpart, horse glycophorin-A plays crucial roles in maintaining erythrocyte integrity and potentially interacts with other membrane proteins such as band 3.

Human glycophorin-A has been extensively studied and shows distinct diffusion properties in erythrocyte membranes. Research suggests that at least a fraction of human glycophorin-A has an anchor to the red cell cytoskeleton that is independent of band 3 . While less is known about horse glycophorin-A specifically, researchers can apply similar methodologies using biotinylated specific binding fragments, such as camel VHH fragments, to study the diffusion properties of horse glycophorin-A in intact equine erythrocytes.

What expression systems are most effective for producing recombinant horse glycophorin-A?

Mammalian expression systems are generally preferred for producing recombinant horse glycophorin-A due to their ability to perform appropriate post-translational modifications, particularly glycosylation, which is essential for the protein's function.

The NS0 murine myeloma cell line has proven effective for recombinant glycoprotein expression, capable of secreting up to 2.7 mg/mL of recombinant protein . After transfection with appropriate expression vectors containing the horse glycophorin-A sequence, cells should be selected using antibiotics such as Geneticin (G418) and subsequently cloned by limiting dilution to isolate high-expressing clones. The expected yield may vary between 50-200 ng/mL in culture supernatants, requiring optimization of culture conditions and possibly concentration steps using methods such as ammonium sulfate precipitation .

How can researchers detect and quantify recombinant horse glycophorin-A?

A glycophorin-binding ELISA represents one of the most reliable methods for detecting and quantifying recombinant horse glycophorin-A. This approach can be optimized through checkerboard titration to determine optimal coating concentrations of glycophorin for maximal antibody binding.

Methodology:

  • Coat ELISA plates with approximately 50 ng of glycophorin (optimal concentration should be determined experimentally)

  • Block non-specific binding sites

  • Add primary antibody (monoclonal antibodies against horse glycophorin-A)

  • Add detection system (enzyme-conjugated secondary antibody)

  • Develop and measure absorbance

Standard curves established with hybridoma-derived monoclonal antibodies can be used to quantitate recombinant glycophorin-A . For confirmation of glycosylation state, researchers can perform glycosidase digestion with enzymes such as PNGase F, followed by gel electrophoresis to observe shifts in molecular weight.

What functional assays can validate recombinant horse glycophorin-A activity?

Direct red cell agglutination assays represent a primary functional validation method for recombinant horse glycophorin-A. In this approach, the recombinant protein is allowed to bind to erythrocytes, followed by addition of an appropriate antibody that can cross-link the bound recombinant protein, resulting in visible agglutination.

Methodology:

  • Concentrate recombinant horse glycophorin-A using ammonium sulfate precipitation or other suitable methods

  • Add approximately 20 ng of concentrated protein to erythrocyte suspensions

  • Add appropriate antibody (approximately 0.5 μg) that recognizes the recombinant protein

  • Observe for agglutination

Appropriate negative controls should include irrelevant antibodies and non-glycophorin-binding proteins . Successful agglutination indicates that the recombinant horse glycophorin-A is properly folded and capable of cell surface binding.

What purification strategies work best for recombinant horse glycophorin-A?

Purification of recombinant horse glycophorin-A typically involves a multi-step process optimized for glycoproteins:

  • Initial Concentration: Ammonium sulfate precipitation can be used to concentrate the protein from culture supernatants, as demonstrated in agglutination reagent studies .

  • Affinity Chromatography: Lectin-based affinity chromatography (using lectins that bind to sialic acid residues) or immunoaffinity chromatography using anti-glycophorin antibodies.

  • Ion Exchange Chromatography: Due to glycophorin-A's acidic nature (from sialic acid residues), anion exchange chromatography can be effective.

  • Size Exclusion Chromatography: As a final polishing step to remove aggregates and obtain homogeneous protein.

  • Quality Control: SDS-PAGE, Western blotting, and mass spectrometry should be used to confirm purity and integrity of the recombinant protein.

Researchers should validate the purification process by assessing protein functionality in binding assays following each purification step.

How can transcriptional profiling enhance recombinant horse glycophorin-A expression?

Transcriptional profiling can identify genes and pathways that influence glycophorin expression, potentially allowing optimization of recombinant production. Research on human erythropoiesis has identified transcriptional signatures associated with erythrocyte membrane proteins, including glycophorins.

A study of recombinant human erythropoietin (rHuEPO) administration identified a 34-transcript signature including glycophorin B (GYPB) and glycophorin E (GYPE) . This suggests that transcription factors regulating these genes could be leveraged to enhance recombinant glycophorin-A expression.

Methodology:

  • Analyze transcriptional profiles of cells under different expression conditions

  • Identify transcription factors regulating glycophorin expression

  • Modify expression vectors to include relevant transcription factor binding sites

  • Engineer expression cell lines to overexpress beneficial transcription factors

This approach could significantly increase yield and quality of recombinant horse glycophorin-A production.

What are the key differences in post-translational modifications between native and recombinant horse glycophorin-A?

Native horse glycophorin-A features extensive O-linked and N-linked glycosylation patterns that can be challenging to reproduce in recombinant systems. These modifications affect protein stability, antigenic properties, and functional interactions.

Researchers should consider:

  • Expression System Selection: Mammalian expression systems like NS0 cells provide more authentic glycosylation than bacterial or insect cell systems .

  • Glycosylation Analysis: Compare native and recombinant glycophorin-A using:

    • Mass spectrometry for detailed glycan profiling

    • Glycosidase digestion with PNGase F or O-glycosidase

    • Lectin binding assays to characterize specific carbohydrate structures

  • Functional Impact Assessment: Determine how differences in glycosylation affect:

    • Binding to antibodies or other interaction partners

    • Stability in solution and on cell membranes

    • Agglutination potential in functional assays

Understanding these differences is critical for interpreting research findings using recombinant horse glycophorin-A.

How can genetic engineering approaches improve recombinant horse glycophorin-A properties?

Strategic genetic modifications can enhance expression, stability, and functionality of recombinant horse glycophorin-A:

  • Codon Optimization: Adjusting codons to match the preference of the expression host can significantly increase protein yield.

  • Signal Sequence Modification: Optimizing the signal peptide can improve secretion efficiency in mammalian expression systems.

  • Fusion Tag Integration: Adding purification tags (His, FLAG) or solubility-enhancing partners (SUMO, MBP) can facilitate purification and improve stability. For example, scFv constructs linked to constant light chain genes (scFv-CL) have been successfully used to generate functional glycophorin-binding reagents .

  • Glycosylation Site Engineering: Modifying or introducing glycosylation sites can enhance stability or function. Confirmed glycosylation of NS0-secreted recombinant proteins can be verified by PNGase F digestion .

  • Membrane Interaction Domains: For functional studies requiring membrane association, fusion to appropriate membrane-anchoring domains.

Each modification should be systematically tested for effects on expression level, stability, and functional properties.

What analytical techniques are essential for structural characterization of recombinant horse glycophorin-A?

Comprehensive structural characterization of recombinant horse glycophorin-A requires multiple complementary techniques:

TechniqueApplicationKey ParametersInformation Obtained
Circular DichroismSecondary structure analysisFar-UV spectra (190-260 nm)α-helix, β-sheet content
Mass SpectrometryMolecular weight, glycosylationMALDI-TOF, ESI-MSExact mass, PTM mapping
NMR SpectroscopySolution structure2D HSQC, NOESYAtomic-level structure
X-ray CrystallographyHigh-resolution structureDiffraction to <3ÅPrecise 3D coordinates
Size Exclusion ChromatographyOligomeric stateCalibrated columnMolecular size, aggregation
Glycan AnalysisCarbohydrate compositionHPAEC-PAD, MSDetailed glycan structures
Surface Plasmon ResonanceBinding kineticska, kd, KD valuesInteraction parameters

For membrane proteins like glycophorin-A, additional techniques such as detergent solubilization optimization or nanodiscs/liposome reconstitution may be necessary to maintain native-like structure during analysis.

What are the methodological approaches to study interactions between recombinant horse glycophorin-A and other membrane proteins?

Investigating interactions between recombinant horse glycophorin-A and other membrane proteins, such as band 3, requires specialized techniques for membrane protein complexes:

  • Co-immunoprecipitation: Using antibodies against glycophorin-A or potential interacting partners to pull down protein complexes. Evidence from human studies shows conflicting results regarding glycophorin-A interaction with band 3, suggesting careful experimental design is needed .

  • Förster Resonance Energy Transfer (FRET): Label glycophorin-A and potential binding partners with appropriate fluorophores to detect proximity-based energy transfer.

  • Single Particle Tracking: Similar to the approach used for human glycophorin-A, quantum dot-labeled camel VHH fragments specific to horse glycophorin-A can monitor diffusion properties in intact erythrocytes .

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by MS analysis can identify interaction interfaces at the amino acid level.

  • Surface Plasmon Resonance: For quantitative binding kinetics between purified proteins.

  • Bimolecular Fluorescence Complementation: Split fluorescent protein assays can visualize interactions in living cells.

When interpreting results, researchers should consider that interactions may be transient or dependent on specific membrane environments, as suggested by the conflicting evidence regarding human glycophorin-A and band 3 interaction .

How can researchers optimize the stability of recombinant horse glycophorin-A during storage and experimentation?

Maintaining stability of recombinant horse glycophorin-A requires careful optimization of buffer conditions and storage protocols:

  • Buffer Composition:

    • pH optimization typically between 6.5-7.5

    • Ionic strength adjustment (usually 150-300 mM NaCl)

    • Addition of stabilizing agents such as glycerol (10-20%)

    • Inclusion of protease inhibitors to prevent degradation

  • Storage Conditions:

    • Aliquoting to minimize freeze-thaw cycles

    • Flash freezing in liquid nitrogen

    • Storage at -80°C for long-term or -20°C for short-term

    • Addition of cryoprotectants for freeze-thaw stability

  • Stability Monitoring:

    • Regular SDS-PAGE analysis to check for degradation

    • Activity assays (e.g., glycophorin-binding ELISA) to confirm functionality

    • Thermal shift assays to identify optimal buffer conditions

  • Membrane Protein Considerations:

    • Addition of appropriate detergents at concentrations above CMC

    • Alternative stabilization in nanodiscs or liposomes

    • Avoidance of extreme temperatures that can disrupt protein-lipid interactions

These approaches should be systematically tested and validated for each recombinant horse glycophorin-A construct.

How can differential gene expression analysis improve recombinant horse glycophorin-A production systems?

Differential gene expression analysis can identify cellular pathways affecting recombinant glycophorin-A expression, enabling targeted optimization of production systems:

  • Transcriptional Profiling Approach:

    • Compare high vs. low producing cell clones

    • Analyze expression under different culture conditions

    • Monitor temporal changes during production cycles

  • Key Pathways to Analyze:

    • Protein folding and quality control (ER stress response)

    • Glycosylation machinery

    • Secretory pathway components

    • Energy metabolism genes

  • Implementation Strategy:

    • Identify rate-limiting steps in expression

    • Engineer cell lines to overexpress beneficial factors

    • Knockout detrimental genes using CRISPR/Cas9

    • Optimize media composition based on metabolic profiles

Research on human erythropoiesis has identified gene expression signatures related to red blood cell development, including glycophorins. A study identified 32 genes profoundly upregulated during rHuEPO administration, including glycophorin B (GYPB) and glycophorin E (GYPE) . The functions of these identified genes were mainly related to the functional and structural properties of red blood cells, providing insight into pathways relevant to glycophorin expression.

Gene CategoryExample GenesRelevance to Glycophorin Production
Erythrocyte Membrane ProteinsGYPB, GYPE, SLC4A1, EPB42Direct structural/functional relevance
Heme SynthesisALAS2, FECHSupport erythroid differentiation
Cell Cycle ControlE2F2Regulate proliferation vs. differentiation
RNA ProcessingRBM38Post-transcriptional regulation
Protein Quality ControlMARCH8, YOD1Ensure proper folding/processing

By understanding these pathways, researchers can design improved expression systems specifically optimized for recombinant horse glycophorin-A production.

What are common pitfalls in recombinant horse glycophorin-A expression and how can they be addressed?

Recombinant horse glycophorin-A expression faces several challenges that researchers should anticipate:

  • Low Expression Levels:

    • Solution: Screen multiple clones (using limiting dilution cloning) to identify high producers

    • Optimize codon usage for the expression host

    • Use strong promoters and enhancers in expression vectors

    • Current expectations: 50-200 ng/mL in supernatants from stable transfectants

  • Improper Glycosylation:

    • Solution: Select appropriate mammalian expression systems (NS0 cells have demonstrated successful glycosylation)

    • Verify glycosylation status using PNGase F digestion

    • Consider engineering glycosylation sites if necessary

  • Protein Aggregation:

    • Solution: Optimize buffer conditions

    • Add mild detergents or stabilizing agents

    • Consider fusion partners that enhance solubility

  • Functional Deficiencies:

    • Solution: Validate activity using functional assays like direct red cell agglutination

    • Include appropriate controls in functional testing (e.g., non-glycophorin-binding proteins and irrelevant antibodies)

  • Batch-to-Batch Variability:

    • Solution: Establish standardized production protocols

    • Implement rigorous quality control testing

    • Create reference standards for comparative analysis

How can researchers validate the structural integrity of recombinant horse glycophorin-A?

Comprehensive validation of recombinant horse glycophorin-A structural integrity requires multiple complementary approaches:

  • Immunological Methods:

    • Western blotting with conformation-specific antibodies

    • ELISA using antibodies recognizing different epitopes

    • Surface plasmon resonance for binding kinetics

  • Biophysical Characterization:

    • Circular dichroism to assess secondary structure

    • Fluorescence spectroscopy for tertiary structure information

    • Differential scanning calorimetry for thermal stability

  • Functional Validation:

    • Glycophorin-binding assays

    • Red cell agglutination tests with specific antibodies

    • Testing approximately 20 ng of concentrated protein with 0.5 μg of appropriate antibody should produce visible agglutination if the protein is properly folded

  • Mass Spectrometry:

    • Intact protein mass analysis

    • Peptide mapping after protease digestion

    • Glycan profiling to verify post-translational modifications

  • Dynamic Light Scattering:

    • Assess homogeneity and detect aggregation

    • Monitor stability under different storage conditions

A multi-method approach provides the most comprehensive validation of structural integrity.

How can recombinant horse glycophorin-A be used in developing equine-specific blood typing systems?

Recombinant horse glycophorin-A offers significant potential for developing improved equine blood typing systems:

  • Development of Standardized Reagents:

    • Recombinant scFv-based agglutination reagents specific to horse glycophorin-A epitopes

    • Production of consistent, highly-specific reagents that overcome limitations of polyclonal antisera

    • Functionality can be validated in direct red cell agglutination assays

  • Novel Blood Group Identification:

    • Screening for polymorphisms in horse glycophorin-A

    • Creation of recombinant variants representing different blood groups

    • Development of monoclonal antibodies against specific epitopes

  • Multiplex Detection Systems:

    • Design of glycophorin-binding ELISA systems for multiple blood group detection

    • Development of microarray-based typing with recombinant proteins

    • Creation of flow cytometry panels using fluorescently-labeled recombinant proteins

  • Quality Control Applications:

    • Use as reference standards for blood typing reagents

    • Development of proficiency testing materials

    • Standardization of equine blood banking procedures

These applications could significantly advance equine transfusion medicine and breeding verification practices.

What insights can comparative studies between horse and human glycophorin-A provide for evolutionary biology?

Comparative studies of recombinant horse and human glycophorin-A can reveal important evolutionary insights:

  • Structural Conservation and Divergence:

    • Sequence analysis shows conserved transmembrane regions but variable extracellular domains

    • Comparative modeling can identify conserved functional motifs

    • Analysis of glycosylation patterns reveals species-specific adaptations

  • Functional Adaptation:

    • Different interaction patterns with cytoskeletal proteins

    • Species-specific resistance to pathogens that target glycophorins

    • Comparative diffusion studies using single particle tracking as performed with human glycophorin-A

  • Molecular Evolution Analysis:

    • Calculation of selection pressures on different protein domains

    • Identification of rapidly evolving regions that may indicate host-pathogen co-evolution

    • Comparison with other species to establish evolutionary relationships

  • Disease Resistance Implications:

    • Analysis of species-specific pathogen binding sites

    • Identification of protective polymorphisms (similar to the Duffy blood group system's association with malaria resistance in humans)

    • Development of models for host-pathogen interactions

These comparative studies can contribute to our understanding of both evolutionary biology and species-specific disease susceptibilities.

How can recombinant horse glycophorin-A contribute to understanding equine hematological disorders?

Recombinant horse glycophorin-A can serve as a valuable tool for investigating equine hematological disorders:

  • Functional Studies:

    • In vitro assessment of mutant glycophorin-A variants associated with disorders

    • Analysis of protein-protein interactions affected by mutations

    • Development of functional assays for diagnostic purposes

  • Diagnostic Applications:

    • Creation of antibodies against specific glycophorin-A epitopes altered in disorders

    • Development of glycophorin-binding ELISAs for quantitative assessment

    • Standardized reagents for clinical testing

  • Structure-Function Relationships:

    • Mapping of critical functional domains through site-directed mutagenesis

    • Identification of binding partners through pull-down assays

    • Correlation of structural alterations with clinical manifestations

  • Therapeutic Development:

    • Creation of recombinant proteins to correct deficiencies

    • Development of targeted therapies for membrane protein disorders

    • Screening platforms for identifying compounds that stabilize mutant proteins

The methodological approaches established in human erythrocyte research, such as single particle tracking of membrane proteins , can be adapted for equine studies using recombinant horse glycophorin-A as a tool.

What controls are essential when working with recombinant horse glycophorin-A?

Rigorous experimental design for recombinant horse glycophorin-A research requires comprehensive controls:

  • Expression System Controls:

    • Untransfected host cells

    • Cells expressing irrelevant recombinant proteins

    • Empty vector transfections

  • Functional Assay Controls:

    • Native horse glycophorin-A (positive control)

    • Irrelevant proteins (negative control)

    • Non-specific antibodies in agglutination assays

    • For direct red cell agglutination assays, include control antibodies that do not recognize the recombinant protein

  • Structural Analysis Controls:

    • Heat-denatured samples

    • Enzymatically deglycosylated samples

    • Species-specific controls (e.g., human glycophorin-A)

  • Purification Controls:

    • Starting material retention samples

    • Flow-through from each purification step

    • Known concentration standards

  • Storage Stability Controls:

    • Fresh protein aliquots

    • Time-course stability samples

    • Different storage condition comparisons

Implementation of these controls ensures experimental rigor and facilitates troubleshooting when unexpected results occur.

How can researchers address the challenges of protein-protein interaction studies with recombinant horse glycophorin-A?

Protein-protein interaction studies with recombinant horse glycophorin-A present unique challenges that require specialized approaches:

  • Membrane Environment Reconstitution:

    • Detergent micelle selection for maintaining native conformation

    • Nanodisc or liposome incorporation for lipid bilayer context

    • Cell membrane extracts for physiological environment

  • Interaction Detection Methods:

    • Split-reporter assays (e.g., split-luciferase) for in vivo detection

    • Microscale thermophoresis for label-free interaction analysis

    • Blue native PAGE for maintaining complexes during separation

    • Single particle tracking methods can reveal interaction dynamics, as demonstrated with human glycophorin-A

  • Transient Interaction Capture:

    • Chemical crosslinking to stabilize fleeting interactions

    • Hydrogen-deuterium exchange mass spectrometry for interaction mapping

    • Temperature-dependent interaction studies

  • Quantitative Analysis:

    • Multiple detection methods for cross-validation

    • Careful control selection to account for non-specific binding

    • Statistical analysis of replicate experiments

  • Computational Support:

    • Molecular docking to predict interaction interfaces

    • Molecular dynamics simulations of membrane protein complexes

    • Network analysis for identifying interaction partners

These approaches help overcome the inherent difficulties in studying membrane protein interactions while providing reliable, quantitative data.

How can transcriptional profiling inform the optimization of recombinant horse glycophorin-A expression?

Transcriptional profiling offers powerful insights for optimizing recombinant horse glycophorin-A expression:

  • Comparative Expression Analysis:

    • Profiling high vs. low producing cell clones

    • Temporal analysis during production cycle

    • Cross-comparison of different expression hosts

  • Relevant Gene Networks:

    • Erythroid differentiation pathways that regulate glycophorin expression

    • Secretory pathway components for protein processing and export

    • Stress response genes indicating production bottlenecks

  • Application Methodology:

    • RNA-Seq for genome-wide expression analysis

    • qRT-PCR for targeted gene expression monitoring

    • RNA interference to validate gene function

    • Use of k-nearest neighbors method for prediction modeling, similar to approaches used in EPO studies

Studies of erythropoiesis have identified key transcriptional signatures related to red blood cell development, including genes like GYPB and GYPE that are regulated during erythropoietin administration . These findings suggest potential targets for engineering expression systems:

PathwayKey GenesOptimization Strategy
Erythroid DevelopmentGYPB, GYPE, EPB42, SLC4A1Engineer cells with erythroid transcription factors
Protein FoldingBCL2L1, SELENBP1Overexpress chaperones
Heme MetabolismALAS2, FECHOptimize iron availability in media
Cell CycleE2F2Control growth/production phase transition
RNA ProcessingRBM38Enhance mRNA stability

By targeting these pathways, researchers can develop cell lines and culture conditions specifically optimized for recombinant horse glycophorin-A expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.