Recombinant Horse Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Mechanism

MC1R is a seven-transmembrane domain protein encoded by the MC1R gene. In horses, it regulates melanin synthesis by responding to α-melanocyte-stimulating hormone (α-MSH) and related ligands. Activation of MC1R triggers cAMP signaling, promoting eumelanin (black/brown pigment) production over pheomelanin (red/yellow pigment) .

Key Domains and Signaling Pathways

  • Transmembrane Domains: Critical for ligand binding and receptor stability. Mutations in these regions (e.g., Ser83Phe in horses) disrupt MC1R function, leading to pheomelanin dominance .

  • Intracellular Signaling:

    • Primary Pathway: cAMP/PKA-mediated pathway, driving melanin synthesis.

    • Secondary Pathway: ERK1/2 activation, influencing cell proliferation and survival .

Genetic Basis of Coat Color in Horses

MC1R variants determine base coat color through interactions with the ASIP (agouti signaling protein) and KIT genes.

MC1R Genotypes and Phenotypes

GenotypeDescriptionCoat ColorPigment Type
E/E or E/eFunctional MC1RBlack, Bay, or GrayEumelanin
e/eNonfunctional MC1R (C901T)ChestnutPheomelanin

The recessive e/e genotype (C901T mutation) abolishes MC1R signaling, resulting in pheomelanin production .

Epistatic Interactions

  • ASIP: The a/a allele (11-bp deletion) suppresses pheomelanin synthesis, yielding black coats when combined with E/- .

  • KIT: A missense variant (rs1140732842) epistatic to MC1R increases white spotting in chestnut horses (e/e) .

Applications in Research

Recombinant MC1R is used to study melanogenesis, disease mechanisms, and therapeutic targets.

Experimental Models

ApplicationExperimental DesignKey Findings
Melanogenesisα-MSH stimulation of recombinant MC1R in vitrocAMP-dependent eumelanin synthesis; ERK1/2 activation in variant MC1R .
DNA RepairUV-induced chromatin damage in melanocytesMC1R-deficient cells show increased chromosome instability .
Cardiac HypertrophyMC1R knockout in cardiomyocytesAttenuated hypertrophic response; reduced diastolic function .

Production and Characterization

Recombinant MC1R is typically produced via bacterial or mammalian expression systems.

Production Parameters

ParameterDetails
SourceE. coli (His-tagged) or mammalian cells (e.g., HEK293) .
Purity>90% by SDS-PAGE; confirmed via Western blotting .
StabilityEnhanced by glycerol (50% final concentration); avoid freeze-thaw cycles .

Signaling Efficiency

MC1R VariantcAMP SignalingERK1/2 ActivationPigment Type
Wild-typeHighModerateEumelanin
R151C/D294HLowHighMixed

Variants like R151C and D294H exhibit biased signaling, prioritizing ERK1/2 over cAMP, which may contribute to melanoma risk .

Clinical and Agricultural Implications

  • Melanoma Risk: MC1R variants (e.g., R151C, D294H) correlate with increased UV sensitivity and melanoma susceptibility .

  • Coat Color Breeding: Genetic testing for MC1R and ASIP alleles enables precise selection for desired phenotypes .

  • White Spotting: KIT variants interact with MC1R to enhance white markings, influencing equine breeding strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Equus caballus (Horse)
Target Names
Target Protein Sequence
MPLQGPQRRLLGSLNSTLPATPYLGLTTNQTEPPCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYYFICCLAVSDLLVSMSNVLEMAILLLLEAGVLATQASVLQQLDNII DVLICGSMVSSLCFLGSIAVDRYISIFYALRYHSIMMLPRVWRAIVAIWVVSVLSSTLFI AYYNHTAVLLCLVTFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQHPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLLILCPQHPTCGCVFKNFKLFLTLILCSAIVDPLIYAF RSQELRKTLQEVLLCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) serves as a receptor for α, β, and γ-MSH, as well as ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. MC1R plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Gene References Into Functions
  1. No significant relationship with behavior at the MC1R locus PMID: 26884605
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Horse Melanocyte-stimulating hormone receptor (MC1R)?

Recombinant Horse Melanocyte-stimulating hormone receptor (MC1R) is a laboratory-produced protein that replicates the naturally occurring MC1R receptor in horses. This G-protein coupled receptor, also known as MSH-R or Melanocortin receptor 1, is primarily involved in the regulation of melanogenesis and pigment switching in equine melanocytes. The recombinant form is typically produced using expression systems such as E. coli, yeast, baculovirus, or mammalian cell lines, with purification levels generally achieving ≥85% as determined by SDS-PAGE analysis . This protein is critical for studying melanocyte function, pigmentation genetics, and increasingly, for investigating pain modulation pathways in horses.

What expression systems are commonly used for producing Recombinant Horse MC1R?

Recombinant Horse MC1R can be produced using several expression systems, each with distinct advantages for different research applications:

  • E. coli expression system: Offers high yield and cost-effectiveness, though may present challenges with post-translational modifications.

  • Yeast expression system: Provides better eukaryotic post-translational modifications than bacterial systems.

  • Baculovirus expression system: Enables production in insect cells with more complex modifications.

  • Mammalian cell expression system: Yields proteins with modifications most similar to native equine proteins.

  • Cell-free expression system: Allows rapid production without cellular constraints.

The purity of recombinant MC1R from these systems typically reaches greater than or equal to 85% as determined by SDS-PAGE analysis . Selection of the appropriate expression system should be based on specific research requirements, including the need for post-translational modifications, protein folding, and functional activity.

How does MC1R function in equine coat color determination?

MC1R functions as a key regulator in the melanin synthesis pathway of horses, determining whether eumelanin (black/brown pigment) or pheomelanin (red/yellow pigment) is produced. The receptor responds to α-melanocyte stimulating hormone (α-MSH), which activates the receptor to stimulate eumelanin production.

The basic genetic model involves the interaction between MC1R (E locus) and ASIP (A locus):

  • When MC1R is fully functional (E/E genotype), it promotes eumelanin production

  • The E locus has multiple alleles including E (dominant, functional) and e (recessive, loss of function)

  • ASIP acts as an antagonist to MC1R by inhibiting eumelanin production in horse body melanocytes

This interaction creates phenotypic variation:

  • Black coat: E/E or E/e at MC1R with a/a at ASIP (64.5% of black horses have E/E genotype)

  • Bay coat: E/E or E/e at MC1R with A/A at ASIP (83.0% of bay horses have A/A genotype)

  • Chestnut coat: e/e at MC1R (regardless of ASIP genotype)

The frequency of E/E genotype decreases as coat color lightens from dark to light (black=64.5%, brown=67.5%, dark bay=47.0%, bay=16.5%, chestnut=0.0%), demonstrating the gradient effect of MC1R expression on pigmentation intensity .

What methodologies are most effective for studying MC1R function in equine pain modulation pathways?

Recent research suggests MC1R involvement in equine pain modulation, particularly in opioid sensitivity. When investigating this relationship, researchers should employ a multi-faceted methodological approach:

  • Genotype-phenotype correlation studies: Compare MC1R variants (E/E, E/e, E/ea) with observed variations in opioid responses, controlling for confounding factors such as breed, age, and health status.

  • Ex vivo receptor binding assays: Utilize recombinant MC1R proteins to assess binding affinity with opioid compounds under controlled conditions.

  • Immunohistochemistry: Examine MC1R expression in the periaqueductal grey (PAG) descending pathway of equine brain tissue, as this region contains opioid receptors and plays a crucial role in pain modulation .

  • Functional cell-based assays: Develop in vitro models using cells expressing different MC1R variants to evaluate downstream signaling pathways activated by both melanocortin and opioid receptor stimulation.

  • Clinical trials with genetic stratification: Design studies that account for MC1R genotype when evaluating opioid efficacy in clinical settings, as this may explain previously observed inconsistencies in opioid effectiveness between healthy and pain-presenting horses .

The methodological challenge lies in isolating MC1R effects from other variables influencing opioid metabolism. Current research indicates that MC1R may influence the PAG descending pathway and immune responses containing opioid receptors, similar to patterns observed in humans, though this relationship requires further exploration in equine models .

How should researchers account for MC1R genetic variation when designing equine studies?

When designing equine studies involving MC1R, researchers must implement a comprehensive genetic stratification strategy:

  • Precise genotyping protocol: Utilize PCR-based methods targeting the polymorphic regions of MC1R. Primer design should be based on the horse genome (e.g., EquCab 3.0), with recommended primer sequences:

    • MC1R-forward: 5′-TGACCACCAACCAGACGGA-3′

    • MC1R-reverse: 5′-CGAGACAGAGCAGGACAGC-3′

  • Phenotype documentation: Accurately document coat color using standardized classification (black, brown, dark bay, bay, chestnut) with photographic evidence to establish clear phenotype-genotype correlations.

  • Statistical power analysis: Account for allele frequencies when calculating required sample sizes. Consider that E/E genotype frequencies vary significantly across coat colors (from 0% in chestnut to 67.5% in brown horses) .

  • Breed stratification: Control for breed-specific genetic backgrounds that may influence MC1R function through epistatic interactions.

  • Functional validation: For novel or rare variants, conduct in vitro functional studies to determine the impact on receptor activity before making phenotypic associations.

This approach allows researchers to account for the complex relationships between MC1R variants and physiological outcomes, enhancing the validity of research findings across diverse equine populations.

What are the current technical challenges in producing functional Recombinant Horse MC1R for research applications?

Producing functionally active Recombinant Horse MC1R presents several technical challenges that researchers must address:

  • Membrane protein solubilization: As a G-protein coupled receptor, MC1R contains seven transmembrane domains that create hydrophobic regions difficult to maintain in their native conformation during recombinant expression and purification.

  • Post-translational modifications: Horse MC1R undergoes N-linked glycosylation essential for proper folding and trafficking. Expression systems must be selected based on their ability to perform appropriate modifications, with mammalian systems generally providing the most native-like modifications .

  • Protein stability: Maintaining the stability of purified MC1R is challenging, often requiring careful optimization of buffer conditions, temperature, and the addition of stabilizing agents.

  • Functional validation: Confirming that recombinant MC1R retains ligand-binding capacity and signaling functionality requires development of specialized assays measuring cAMP production or Ca²⁺ mobilization in response to α-MSH.

  • Batch-to-batch consistency: Achieving consistent functional properties across production batches requires rigorous quality control measures beyond the standard ≥85% purity by SDS-PAGE .

Researchers can address these challenges by employing detergent screening approaches, utilizing fusion partners that enhance solubility, and developing robust functional assays specific to horse MC1R activity.

How should researchers interpret discrepancies between in vitro and in vivo MC1R functional studies?

When analyzing discrepancies between in vitro and in vivo MC1R functional studies, researchers should implement a systematic evaluation framework:

  • Context-dependent signaling assessment: MC1R signaling varies in different cellular environments. In vitro studies using recombinant proteins may not capture the complex receptor interactions present in living equine tissues. Examine whether discrepancies relate to the cellular microenvironment or receptor interaction networks.

  • Physiological relevance analysis: Determine if the differences between controlled laboratory conditions and natural biological systems explain the discrepancies. Consider factors like:

    • Presence of endogenous ligands and antagonists (e.g., ASIP) in vivo

    • Inflammation and immune system activation states

    • Hormonal influences on receptor expression and function

  • Genetic background evaluation: Assess whether the host animal's genetic background in in vivo studies contributes to functional variations not observed in isolated systems. The interaction between MC1R and ASIP exemplifies how genotype combinations produce different phenotypic outcomes .

  • Procedural validation: Examine experimental procedures for methodological differences that could explain disparate results, including:

    • Dosing regimens

    • Timing of measurements

    • Sample collection methods

    • Assay sensitivity and specificity

  • Statistical approaches: Utilize statistical methods that account for higher variability in in vivo systems and consider power analyses when designing follow-up studies to resolve discrepancies.

This analytical approach can help researchers determine whether discrepancies represent meaningful biological insights or methodological artifacts, guiding refinement of experimental models.

What statistical approaches are most appropriate for analyzing MC1R genotype-phenotype correlations in equine populations?

When analyzing MC1R genotype-phenotype correlations in equine populations, researchers should employ specialized statistical approaches that account for the complex genetic architecture:

  • Multinomial logistic regression models: For categorical phenotypes like coat color, these models can quantify the relationship between MC1R genotypes and multiple color categories while controlling for confounding variables. This approach revealed that E/E genotype frequency at MC1R decreases from dark to light colors (black=64.5%, brown=67.5%, dark bay=47.0%, bay=16.5%, chestnut=0%) .

  • Epistatic interaction analysis: Statistical models that evaluate gene-gene interactions are essential when analyzing MC1R and ASIP combinations. Different advantage genotype combinations exist for different coat colors, requiring models that capture these non-additive genetic effects .

  • Cox regression for survival analysis: When studying MC1R's potential influence on disease progression (as observed in melanoma studies), Cox proportional hazards models can assess relationships between MC1R variants and outcomes over time. Hazard ratios can quantify these relationships, as demonstrated in human studies (HR: 0.77, 95% CI 0.64–0.93; P=0.005) .

  • Population stratification correction: Methods like principal component analysis should be implemented to account for population structure in diverse equine breeds that may confound genotype-phenotype associations.

  • Bayesian approaches: For complex phenotypes with multiple contributing factors, Bayesian statistical frameworks can incorporate prior biological knowledge about MC1R function and provide probability distributions for effect sizes.

These statistical approaches enhance the ability to detect meaningful associations while minimizing false positives in genotype-phenotype studies of equine MC1R variations.

How might findings on MC1R's role in pain modulation translate to clinical applications in equine veterinary medicine?

Emerging research on MC1R's role in pain modulation has significant translational potential for equine pain management:

  • Genotype-guided analgesic protocols: Understanding the relationship between MC1R variants and opioid sensitivity could enable personalized pain management strategies based on a horse's MC1R genotype. This approach could address the current challenges in equine pain management, including inconsistent antinociceptive results observed with commonly administered analgesics .

  • Molecular mechanisms exploration: Investigating how MC1R influences the periaqueductal grey (PAG) descending pathway may reveal novel targets for pain modulation. Current research suggests MC1R involvement in this pain-modulating pathway, which contains opioid receptors .

  • Improved clinical trial design: Stratifying horses by MC1R genotype (E/E, E/e, E/ea) in analgesic efficacy studies could explain variable responses and lead to more consistent results in clinical settings. This addresses the observed discrepancy in opioid effectiveness between healthy, pain-free horses and those with clinical pain .

  • Biomarker development: MC1R genotyping could serve as a biomarker for predicting opioid response, potentially improving safety by identifying horses at risk for adverse reactions or requiring dose adjustments.

  • Alternative pain management strategies: For horses with MC1R variants associated with decreased opioid sensitivity, research could focus on developing alternative analgesic approaches targeting different pathways.

The translation of these findings could significantly improve pain management in equine veterinary medicine, where current approaches are constrained by challenges in cost, side effects, and inconsistent efficacy .

What are the implications of MC1R research for understanding evolutionary adaptations in equids?

MC1R research provides valuable insights into evolutionary adaptations in equids:

  • Natural selection pressures: Analysis of MC1R and ASIP genotype distribution across equid populations reveals how different coat colors evolved in response to environmental pressures. The maintenance of multiple functional alleles suggests balancing selection might have favored different pigmentation patterns in various environments .

  • Domestication signatures: The distribution of MC1R variants among domestic horse breeds compared to wild equids can illuminate human selection during domestication. Distinctive genotype patterns (E/E, E/e) across breeds reflect artificial selection for desired coat colors .

  • Pleiotropic effects: Beyond coat color, MC1R's involvement in pain modulation and potentially immune response suggests evolutionary trade-offs. The retention of seemingly disadvantageous alleles might be explained by benefits in other physiological systems, such as improved opioid sensitivity or immune function .

  • Adaptive radiation: Comparing MC1R function across different equid species (horses, zebras, donkeys) can help understand how this gene contributed to adaptive radiation within Equidae. Differential expression or function of MC1R may explain species-specific coat patterns.

  • Genetic drift versus selection: Statistical analysis of MC1R allele frequencies across isolated horse populations can distinguish between neutral genetic drift and positive selection, providing insights into the evolutionary forces shaping equid genomes.

This evolutionary perspective on MC1R enhances our understanding of equid adaptation and can inform conservation genetics for endangered equid species as well as breeding programs for domestic horses.

How does MC1R interact with other genes to influence phenotypes beyond coat color in horses?

MC1R interacts with multiple genes and signaling pathways to influence phenotypes beyond coat color:

  • Opioid receptor pathways: Evidence suggests MC1R variants may influence equine opioid sensitivity through interaction with opioid receptor signaling cascades. This interaction could explain variable responses to pain management treatments and involves the periaqueductal grey (PAG) descending pathway .

  • Immune system modulation: MC1R signaling appears to affect immune responses, potentially through interaction with cytokine signaling pathways. This relationship may have implications for inflammation, wound healing, and disease susceptibility in horses with different MC1R variants .

  • ASIP antagonism network: The well-documented interaction between MC1R and ASIP extends beyond simple pigmentation. This signaling network may influence metabolic processes, as ASIP is known to affect energy homeostasis in other species. Research shows that different MC1R-ASIP genotype combinations (e.g., E/E with a/a versus E/E with A/A) create distinct phenotypic outcomes .

  • MITF transcriptional cascade: MC1R regulates the expression of the Microphthalmia-associated transcription factor (MITF), which controls numerous genes beyond those involved in pigmentation. This transcriptional network affects melanocyte development, survival, and function .

  • Melanocortin system cross-talk: As part of the broader melanocortin system, MC1R may interact with other melanocortin receptors (MC2R-MC5R) that regulate stress responses, energy homeostasis, and sexual function.

Understanding these complex gene interactions is crucial for comprehending the full spectrum of MC1R's influence on equine physiology and could reveal new targets for therapeutic intervention in equine medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.