Recombinant Horse NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is NADH-ubiquinone oxidoreductase chain 4L and what is its role in mitochondrial function?

NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a protein encoded by the mitochondrial genome (MT-ND4L gene) that functions as a critical component of Complex I in the mitochondrial respiratory chain. This protein participates in oxidative phosphorylation, the process by which mitochondria convert energy from food into adenosine triphosphate (ATP), the cell's primary energy currency. MT-ND4L specifically contributes to the first step of the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone (also called coenzyme Q10) . Through this electron transfer, Complex I helps establish an electrochemical gradient across the inner mitochondrial membrane, which drives ATP synthesis. The protein is embedded within the inner mitochondrial membrane as part of the larger Complex I structure, enabling the proton motive force required for ATP production .

What is the structural composition of MT-ND4L and how does it compare across species?

MT-ND4L is a small hydrophobic protein consisting of 98 amino acids in horses (Equus caballus). The amino acid sequence is: MSLVHINIFLAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMATMMVLNTHFTLASMMPIILLVFAACERALGLSLLVMVSNTYGVDHVQNLNLLQC . The protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane. While the specific structure varies somewhat across species, the functional domains remain highly conserved due to the protein's essential role in cellular respiration.

How is the MT-ND4L gene organized in the mitochondrial genome?

The MT-ND4L gene is encoded in the mitochondrial genome, not the nuclear genome. In humans, it is located on the mitochondrial chromosome at position NC_012920.1 (10470..10766) . The gene does not contain introns, which is characteristic of mitochondrial genes. It is transcribed and translated within the mitochondria, unlike nuclear-encoded mitochondrial proteins that are translated in the cytoplasm and transported into mitochondria .

The genomic organization of MT-ND4L is particularly interesting because mitochondrial DNA (mtDNA) has unique inheritance patterns (maternal inheritance) and mutation rates that differ from nuclear DNA. This organization has significant implications for understanding mitochondrial disorders, as mutations in MT-ND4L can affect all mitochondria within a cell and potentially all cells containing those mitochondria .

What are the current methods for producing recombinant horse MT-ND4L protein for research purposes?

Recombinant horse MT-ND4L protein is typically produced using bacterial, yeast, or mammalian expression systems. The methodology involves several critical steps:

• Gene synthesis or cloning: The MT-ND4L coding sequence is either synthesized based on the known sequence or cloned from horse mitochondrial DNA.

• Expression vector construction: The gene is inserted into an appropriate expression vector containing necessary regulatory elements.

• Host cell transformation: The expression construct is introduced into a suitable host system (commonly E. coli, yeast, or mammalian cell lines).

• Protein expression induction: Expression is induced under controlled conditions, optimizing for protein yield and solubility.

• Protein purification: Multi-step purification typically involving affinity chromatography using engineered tags (as mentioned in the product description, "The tag type will be determined during production process") .

• Quality control: Verification of protein identity, purity, and functionality through methods such as mass spectrometry, SDS-PAGE, and functional assays.

Due to the hydrophobic nature of MT-ND4L, special considerations for membrane protein expression are required, including the use of detergents or lipid nanodisc systems to maintain proper folding and functionality .

How can researchers effectively study MT-ND4L protein dynamics and conformational changes?

Studying MT-ND4L dynamics requires specialized approaches due to its membrane-embedded nature. Current methodological approaches include:

• AI-Driven Conformational Ensemble Generation: Advanced AI algorithms can predict alternative functional states of MT-ND4L, including large-scale conformational changes along collective coordinates. This approach involves molecular simulations with AI-enhanced sampling and trajectory clustering to explore the conformational space of the protein and identify representative structures .

• Molecular Dynamics Simulations: These simulations can reveal the protein's dynamic behavior by tracking atomic movements over time. For MT-ND4L, specialized force fields for membrane proteins are essential.

• Cryo-Electron Microscopy (Cryo-EM): This technique can capture multiple conformational states of Complex I, including the MT-ND4L component, providing insight into structural transitions during the catalytic cycle.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This approach can identify regions of conformational flexibility and solvent accessibility, helping to map dynamic domains within the protein.

• Diffusion-based AI models and active learning AutoML: These techniques generate statistically robust ensembles of equilibrium protein conformations that capture the receptor's full dynamic behavior, providing a foundation for structure-based drug design .

The integration of these methods yields a comprehensive understanding of MT-ND4L structural dynamics that is critical for elucidating its function and developing potential therapeutic interventions.

What techniques are most effective for identifying binding pockets and interaction sites on MT-ND4L?

Several complementary techniques can be employed to identify and characterize binding pockets on MT-ND4L:

• AI-based pocket prediction: Advanced algorithms can discover orthosteric, allosteric, hidden, and cryptic binding pockets on MT-ND4L's surface. These approaches integrate literature knowledge with structure-aware ensemble-based detection algorithms that leverage protein dynamics data .

• Molecular docking and virtual screening: Computational methods to identify potential ligand binding sites and predict binding modes of small molecules.

• Site-directed mutagenesis: Experimental validation of predicted binding sites by systematically altering amino acids and assessing functional consequences.

• Photoaffinity labeling: Using photoactivatable ligands to covalently bind to proteins at their interaction sites, followed by mass spectrometry identification.

• Hydrogen/deuterium exchange mass spectrometry (HDX-MS): Identifies regions protected from solvent exchange upon ligand binding, indicating binding interfaces.

The most robust approach combines computational predictions with experimental validation. For instance, AI scoring and ranking of tentative pockets can be performed simultaneously with detection of favorable physicochemical properties, followed by experimental confirmation through binding assays or structural biology techniques .

What are the optimal conditions for storage and handling of recombinant MT-ND4L to maintain structural integrity?

Maintaining the structural integrity of recombinant MT-ND4L requires specific storage and handling conditions:

As noted in the product information, "Repeated freezing and thawing is not recommended" . To maximize protein stability, it is advisable to prepare small working aliquots upon first thaw and store the remainder at -80°C. The inclusion of 50% glycerol in the storage buffer helps prevent freezing damage and maintain protein solubility .

How can researchers effectively design experiments to study the role of MT-ND4L mutations in disease pathogenesis?

Designing experiments to study MT-ND4L mutations requires a multi-faceted approach:

• Patient-derived samples analysis: Collect and analyze tissues or cells from patients with confirmed MT-ND4L mutations, focusing on mitochondrial function, ATP production, and reactive oxygen species (ROS) levels.

• CRISPR-based mitochondrial genome editing: Although challenging due to the unique properties of mtDNA, newer techniques allow for targeted modification of mitochondrial genes to introduce specific mutations for study.

• Cybrid cell models: Create transmitochondrial cybrids by fusing cells depleted of mtDNA (ρ° cells) with platelets or mitochondria from patients carrying MT-ND4L mutations.

• Recombinant protein functional assays: Compare wild-type and mutant recombinant MT-ND4L proteins in reconstituted systems to assess differences in:

  • Electron transfer efficiency

  • Complex I assembly

  • ROS production

  • Protein stability and folding

• Systems biology approaches: Integrate transcriptomics, proteomics, and metabolomics data to understand the broader impact of MT-ND4L mutations on cellular pathways.

For example, to study the T10663C (Val65Ala) mutation associated with Leber hereditary optic neuropathy, researchers could generate cybrid cells carrying this mutation and assess Complex I activity, ROS production, ATP synthesis, and cell death in response to metabolic stress, particularly in cells resembling retinal ganglion cells .

What approaches can be used to study interactions between MT-ND4L and other components of Complex I?

Studying the interactions between MT-ND4L and other Complex I components requires specialized techniques for membrane protein complexes:

• Cross-linking coupled with mass spectrometry (XL-MS): This approach can identify amino acid residues in close proximity between MT-ND4L and other subunits, revealing interaction interfaces.

• Blue native polyacrylamide gel electrophoresis (BN-PAGE): Used to analyze intact respiratory chain complexes and assess how mutations or modifications to MT-ND4L affect Complex I assembly.

• Cryo-electron microscopy (cryo-EM): Provides high-resolution structural information about the position and interactions of MT-ND4L within Complex I.

• Computational modeling and molecular dynamics simulations: Predict and analyze protein-protein interactions within Complex I, including those involving MT-ND4L.

• Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to MT-ND4L in living cells.

• Protein-fragment complementation assays: Split reporter proteins fused to MT-ND4L and potential interaction partners can reveal interactions in cellular contexts.

These approaches are particularly valuable for understanding how mutations in MT-ND4L might disrupt interactions with other subunits, potentially explaining the molecular basis of associated diseases .

How can researchers differentiate between the functions of MT-ND4L and nuclear-encoded mitochondrial proteins?

Differentiating between MT-ND4L and nuclear-encoded mitochondrial proteins requires experimental designs that account for their distinct genetic origins and regulation:

• Selective inhibition strategies:

  • Use ethidium bromide or other agents to deplete mtDNA, affecting mitochondrial-encoded proteins like MT-ND4L while leaving nuclear-encoded proteins intact

  • Compare with selective inhibition of cytoplasmic translation using cycloheximide, which affects nuclear-encoded proteins but not mitochondrial translation

• Import assays: Nuclear-encoded mitochondrial proteins require import machinery for translocation into mitochondria, while MT-ND4L is synthesized within the organelle. Experiments blocking protein import can distinguish between these protein classes.

• Expression regulation studies: Analyze how different cellular stresses affect the expression of MT-ND4L versus nuclear-encoded mitochondrial proteins, revealing distinct regulatory mechanisms.

• Evolutionary rate analysis: MT-ND4L typically evolves at a different rate than nuclear-encoded mitochondrial proteins, which can be leveraged in comparative genomics studies.

• Mitoribosomes versus cytosolic ribosomes: Studies using selective ribosomal inhibitors can differentiate proteins synthesized by mitochondrial versus cytosolic translation machinery.

These approaches are crucial for understanding the integrated function of the 2,282 candidate nuclear genes that contribute to mitochondrial function alongside mitochondrially-encoded genes like MT-ND4L .

What methodologies can be used to investigate the impact of MT-ND4L variations on mitochondrial bioenergetics?

Investigating the impact of MT-ND4L variations on mitochondrial bioenergetics requires sophisticated functional assays:

• Oxygen consumption measurements: Using instruments like the Seahorse XF Analyzer to measure oxygen consumption rates (OCR) in cells with different MT-ND4L variants, providing real-time assessment of mitochondrial respiration.

• Complex I activity assays: Spectrophotometric measurements of NADH oxidation rates in isolated mitochondria or permeabilized cells to directly assess Complex I function.

• Membrane potential analysis: Using fluorescent dyes such as TMRM or JC-1 to evaluate mitochondrial membrane potential, which is established in part by Complex I activity.

• ATP synthesis measurements: Quantifying ATP production rates using luminescence-based assays in cells with different MT-ND4L variants.

• Reactive oxygen species (ROS) detection: Measuring superoxide and hydrogen peroxide production using specific fluorescent probes, as Complex I dysfunction often leads to increased ROS generation.

• Metabolic flux analysis: Tracing the metabolism of isotopically labeled substrates to determine how MT-ND4L variations affect metabolic pathways dependent on mitochondrial function.

• In silico modeling: Using structural data and molecular dynamics simulations to predict how specific amino acid changes affect electron transfer and proton pumping efficiency.

These methodologies enable researchers to establish clear correlations between specific MT-ND4L variations and alterations in mitochondrial bioenergetics, providing insight into disease mechanisms .

How does the Val65Ala mutation in MT-ND4L contribute to Leber hereditary optic neuropathy pathophysiology?

The Val65Ala mutation (T10663C) in MT-ND4L has been identified in several families with Leber hereditary optic neuropathy (LHON), although the precise pathophysiological mechanism remains incompletely understood. Based on current research, the following mechanisms are likely involved:

• Altered Complex I function: The substitution of valine with alanine at position 65 appears to reduce Complex I activity, decreasing electron transfer efficiency and ATP production. This is particularly significant in retinal ganglion cells, which have high energy demands.

• Increased reactive oxygen species (ROS) production: Dysfunctional Complex I can lead to electron leakage and increased superoxide generation, causing oxidative stress that preferentially damages retinal ganglion cells.

• Compromised structural integrity: The Val65Ala mutation may destabilize MT-ND4L's interaction with other Complex I subunits, affecting the assembly or stability of the entire complex.

• Retinal ganglion cell specificity: Although the mutation affects all cells, retinal ganglion cells are particularly vulnerable due to their high energy requirements, limited antioxidant capacity, and the unique architecture of unmyelinated retinal nerve fibers.

• Threshold effect: The mutation likely reduces Complex I efficiency to a level that is particularly problematic in tissues with high energy demands, explaining the tissue-specific manifestation of this systemic genetic defect.

Research suggests that this mutation alters the protein structure in a way that compromises Complex I function while not completely abolishing it, leading to the characteristic vision loss in LHON patients .

What are the experimental approaches to explore MT-ND4L's role in diabetes mellitus?

Recent research has implicated MT-ND4L in diabetes mellitus, requiring specialized experimental approaches to understand this connection :

• Genetic association studies: Analyzing mtDNA variants in MT-ND4L among diabetic populations to identify potential risk-associated mutations.

• Pancreatic β-cell models: Creating cellular models with specific MT-ND4L variants to study:

  • Glucose-stimulated insulin secretion

  • Mitochondrial function in β-cells

  • ATP production critical for insulin secretion

  • Calcium signaling dependent on mitochondrial function

• Metabolic profiling: Comprehensive analysis of metabolic changes in models with MT-ND4L variants to understand alterations in glucose metabolism and insulin signaling.

• Oxidative stress assessment: Measuring ROS production and oxidative damage in pancreatic β-cells with MT-ND4L variants, as oxidative stress is a key factor in β-cell dysfunction.

• In vivo models: Developing animal models with specific MT-ND4L mutations using new mitochondrial genome editing techniques to study systemic effects on glucose homeostasis.

• Mitochondrial dynamics analysis: Examining how MT-ND4L variants affect mitochondrial fusion, fission, and mitophagy, processes known to be altered in diabetes.

• Interaction with nuclear genes: Investigating how MT-ND4L variants interact with nuclear-encoded mitochondrial genes and diabetes risk alleles, representing a mitochondrial-nuclear cross-talk mechanism.

These approaches help elucidate the mechanisms by which MT-ND4L dysfunction may contribute to the development of diabetes mellitus, potentially opening new avenues for therapeutic intervention .

What are the emerging therapeutic strategies targeting MT-ND4L dysfunction in mitochondrial disorders?

Emerging therapeutic strategies targeting MT-ND4L dysfunction represent cutting-edge approaches to mitochondrial medicine:

• Gene therapy approaches:

  • Allotopic expression: Delivery of a nuclear-encoded version of MT-ND4L targeted to mitochondria

  • Mitochondrial targeted nucleases: Selective elimination of mutant mtDNA to shift heteroplasmy levels

  • Novel mitochondrial genome editing techniques: Directly correcting mutations in mtDNA

• Small molecule therapeutics:

  • Complex I bypass strategies using alternative electron carriers

  • Compounds that stabilize Complex I assembly or enhance residual activity

  • Antioxidants specifically targeted to mitochondria to reduce ROS-induced damage

• Metabolic manipulation:

  • Ketogenic diets to provide alternative energy substrates bypassing Complex I

  • Supplementation with metabolic precursors to enhance ATP production through alternate pathways

• Mitochondrial replacement therapy:

  • Techniques like pronuclear transfer or maternal spindle transfer to prevent transmission of MT-ND4L mutations

• Structure-based drug design:

  • Using AI-driven conformational ensemble generation and binding pocket characterization to develop compounds that can compensate for MT-ND4L dysfunction

  • Virtual screening of compound libraries against specific MT-ND4L variants to identify potential therapeutic candidates

• Mitochondrial transplantation:

  • Direct transfer of healthy mitochondria into affected tissues to restore function

These therapeutic strategies are in various stages of development, with some already in clinical trials for mitochondrial disorders including those involving MT-ND4L dysfunction .

How can recombinant MT-ND4L be used to develop screening assays for potential therapeutic compounds?

Recombinant MT-ND4L provides a valuable tool for developing screening assays to identify therapeutic compounds:

• Reconstituted Complex I activity assays:

  • Incorporating recombinant MT-ND4L (wild-type or mutant) into liposomes or nanodiscs with other Complex I components

  • Measuring NADH oxidation and ubiquinone reduction in the presence of candidate compounds

  • High-throughput adaptation using plate-based fluorescence or absorbance readouts

• Binding assays for direct interaction:

  • Surface plasmon resonance (SPR) to measure compound binding to recombinant MT-ND4L

  • Microscale thermophoresis (MST) to detect interactions between small molecules and the protein

  • Fluorescence-based thermal shift assays to identify stabilizing compounds

• Structural studies with bound compounds:

  • Cryo-EM analysis of Complex I with incorporated recombinant MT-ND4L in the presence of candidate molecules

  • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

• Competitive displacement assays:

  • Using labeled known binders to MT-ND4L and measuring displacement by candidate compounds

• AI-augmented virtual screening:

  • Leveraging identified binding pockets on MT-ND4L for in silico screening of compound libraries

  • Using the structural data from recombinant protein to train ML models for predicting effective therapeutic molecules

• Cell-based assays incorporating recombinant protein:

  • Delivery of recombinant MT-ND4L into cells to rescue mutant phenotypes

  • Testing compounds that enhance this rescue effect

These screening approaches can identify compounds that stabilize mutant MT-ND4L, enhance its incorporation into Complex I, improve electron transfer efficiency, or reduce harmful ROS production .

How might single-cell analyses advance our understanding of MT-ND4L heteroplasmy in disease progression?

Single-cell analyses offer unprecedented opportunities to understand the role of MT-ND4L heteroplasmy in disease:

• Single-cell mtDNA sequencing: New technologies allow for sequencing of mtDNA from individual cells, revealing heteroplasmy levels of MT-ND4L mutations at the single-cell level. This approach can identify critical threshold levels for disease manifestation.

• Combined genetic and functional analysis: Integrating single-cell mtDNA sequencing with functional readouts such as mitochondrial membrane potential, ROS production, or ATP synthesis can establish direct correlations between MT-ND4L mutation load and cellular dysfunction.

• Lineage tracing of heteroplasmy: Following the inheritance and segregation of MT-ND4L variants through cellular divisions to understand the dynamics of heteroplasmy during development and disease progression.

• Spatial transcriptomics with mitochondrial readouts: Mapping the spatial distribution of cells with different MT-ND4L heteroplasmy levels within tissues, particularly in affected organs like the retina in LHON patients.

• Single-cell proteomics: Measuring the adaptive responses in protein expression at the single-cell level in response to different levels of MT-ND4L mutations.

• Heteroplasmy-dependent nuclear responses: Analyzing how nuclear gene expression changes in individual cells based on their specific MT-ND4L heteroplasmy level, revealing compensatory mechanisms.

These approaches can elucidate the cell-specific consequences of MT-ND4L mutations and help explain the variable penetrance and tissue specificity observed in mitochondrial disorders like LHON .

What are the implications of mitochondrial-nuclear genomic interactions for understanding MT-ND4L function?

Mitochondrial-nuclear genomic interactions are critical for comprehensively understanding MT-ND4L function:

• Coordinated gene expression: The function of MT-ND4L depends on coordinated expression with nuclear-encoded Complex I subunits. Research into this coordination reveals regulatory mechanisms that ensure proper stoichiometry and assembly.

• Compensatory nuclear adaptations: Nuclear genes may adapt to MT-ND4L mutations through altered expression patterns, potentially explaining variable disease penetrance and phenotypic expression.

• Mitonuclear mismatch: Evolutionary studies suggest that optimal mitochondrial function requires compatibility between mtDNA-encoded proteins like MT-ND4L and nuclear-encoded partners. Population studies can reveal how these interactions affect disease susceptibility.

• Epigenetic regulation: Nuclear epigenetic modifications can influence the expression of nuclear-encoded mitochondrial proteins that interact with MT-ND4L, adding another layer of regulation and potential therapeutic targeting.

• MT-nDNA candidates: Research has identified 2,282 candidate nuclear genes that contribute to mitochondrial function. Understanding how these genes interact with MT-ND4L is essential for a complete picture of mitochondrial biology and disease mechanisms .

• Retrograde signaling: MT-ND4L dysfunction can trigger retrograde signaling from mitochondria to the nucleus, altering nuclear gene expression as an adaptive response.

• Translational coordination: The different translation machineries (mitochondrial and cytosolic) must be coordinated to ensure proper assembly of complexes containing both mitochondrial and nuclear-encoded subunits.

These interactions highlight the need for integrated research approaches that consider both genomes simultaneously when studying MT-ND4L function and dysfunction .

What are the most promising future directions for MT-ND4L research?

Based on current scientific understanding and technological advances, several promising research directions for MT-ND4L emerge:

• Precision medicine approaches: Developing therapies tailored to specific MT-ND4L mutations, accounting for nuclear genetic background and tissue-specific factors.

• Advanced structural biology: Utilizing cryo-electron microscopy and AI-enhanced structural prediction to understand the detailed molecular mechanisms of MT-ND4L function within Complex I.

• Mitochondrial genome editing: Refining techniques for direct editing of mtDNA to correct pathogenic MT-ND4L mutations in affected tissues.

• Systems biology integration: Combining multi-omics approaches to understand MT-ND4L in the context of the entire cellular metabolic network.

• Tissue-specific manifestations: Investigating why MT-ND4L mutations preferentially affect certain tissues, particularly in Leber hereditary optic neuropathy and diabetes mellitus.

• Evolutionary medicine: Exploring how MT-ND4L variations contributed to human adaptation to different environments and how these variations influence disease susceptibility today.

• Mitochondrial dynamics and MT-ND4L: Understanding how mitochondrial fusion, fission, and mitophagy are influenced by MT-ND4L function and how these processes might be targeted therapeutically.

• Artificial intelligence applications: Leveraging AI for predicting the functional consequences of MT-ND4L variants and designing therapeutic molecules that can compensate for dysfunction .

These research directions promise to advance our understanding of MT-ND4L biology and develop effective interventions for associated diseases .

How might advances in AI and computational biology transform our approach to studying MT-ND4L?

Advances in AI and computational biology are revolutionizing MT-ND4L research in multiple ways:

• Structural prediction and dynamics: AI algorithms can predict MT-ND4L conformational changes and dynamics with unprecedented accuracy, revealing functional states that were previously inaccessible to experimental techniques .

• Variant effect prediction: Deep learning models can predict the functional consequences of MT-ND4L mutations, helping prioritize variants for experimental validation and potential therapeutic intervention.

• Literature mining and knowledge integration: Custom-tailored LLMs can extract and formalize information about MT-ND4L from structured and unstructured data sources, creating comprehensive knowledge graphs that integrate diverse research findings .

• Drug discovery acceleration: AI-driven approaches to binding pocket identification and virtual screening dramatically accelerate the development of compounds targeting MT-ND4L dysfunction .

• Personalized simulation models: Computational models incorporating patient-specific MT-ND4L variants can simulate mitochondrial dysfunction at the individual level, enabling personalized therapeutic strategies.

• Multi-scale modeling: Linking molecular-level MT-ND4L function to cellular and tissue-level phenotypes through computational models that bridge these scales.

• Automated experimental design: ML algorithms can optimize experimental protocols for studying MT-ND4L, maximizing information gain while minimizing resources.

• Integration of heterogeneous data: Computational approaches can integrate genetic, structural, functional, and clinical data related to MT-ND4L, revealing patterns and relationships not apparent from any single data type.