Recombinant Horse Prostaglandin E synthase (PTGES)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Horse PTGES

Recombinant Horse PTGES is produced using a baculovirus overexpression system in Sf21 insect cells, yielding a 21 kDa protein with high purity (≥90%) . Key specifications include:

PropertyDetails
UniProt IDQ8HZJ2 (Equine-specific)
Gene ID9536 (Ortholog of human PTGES)
Catalytic ActivityConverts PGH2 to PGE2 via glutathione-dependent isomerization (EC 5.3.99.3)
Storage ConditionsStable for ≥6 months at -80°C in 50 mM sodium phosphate buffer (pH 7.2) with 20% glycerol
Amino Acid Sequence153 residues, including conserved domains for glutathione binding and catalytic activity

Biological Role in Equine Physiology

PTGES is integral to the arachidonic acid pathway, with PGE2 regulating:

  • Inflammation: Upregulated during joint diseases (e.g., osteoarthritis) .

  • Reproduction: Modulates embryo mobility in mares by influencing uterine PGE2/PGF2α ratios .

  • Pain and Fever: Mediates nociceptive responses in inflammatory conditions .

Table 1: Key Studies on Equine PTGES and PGE2

Study FocusMethodologyOutcomeSource
mPGES-1 InhibitionLPS-stimulated leukocytes treated with MF63 (mPGES-1 inhibitor)Selective reduction of PGE2 (≥80%) without affecting TXA2/PGI2
PGE2 Modulation of MMPsEquine chondrocytes exposed to IL-1β + PGE2PGE2 (10 µg/ml) suppressed IL-1β-induced MMP-1/3/13 expression by 40–60%
Endometrial Gene RegulationEndometrial samples from pregnant vs. nonbred maresPGE2 upregulated PTGES and COX-2 in embryo-containing uterine horns
Therapeutic TargetingIn vitro screening of mPGES-1 inhibitorsCompound 8m (IC50 = 222 nM) showed high selectivity for mPGES-1 over COX-1/2

Therapeutic Implications

  • Anti-Inflammatory Drug Development: Selective mPGES-1 inhibitors (e.g., MF63) reduce PGE2 in leukocytes without disrupting gastroprotective prostaglandins .

  • Osteoarthritis Management: PGE2 suppression mitigates cartilage degradation by downregulating MMPs .

  • Reproductive Health: Modulating uterine PGE2 levels could enhance embryo implantation success in mares .

Comparative Analysis: Human vs. Equine PTGES

FeatureEquine PTGESHuman PTGES
UniProt IDQ8HZJ2 O14684
Expression PatternInduced in inflamed joints and endometrium Upregulated in cancer and chronic inflammation
Inhibitor SensitivityMF63 (IC50 = 0.14 µM in leukocytes) Compound III (IC50 = 0.09 µM in A549 cells)

Future Research Directions

  • In Vivo Efficacy Trials: Validate mPGES-1 inhibitors in equine osteoarthritis models .

  • Gene Editing: CRISPR-based studies to elucidate PTGES roles in mare reproductive cycles .

  • Multi-Omics Integration: Transcriptomic and proteomic profiling of PTGES in inflammatory pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PTGES; Prostaglandin E synthase; Glutathione peroxidase PTGES; Glutathione transferase PTGES; Microsomal prostaglandin E synthase 1; MPGES-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Equus caballus (Horse)
Target Names
PTGES
Target Protein Sequence
MPPPSLAMVSGQALPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALRHGGLQFH RDDQDVERCLRAHRNDMETIYPFLFLGLVYSFLGPDPFVAQMHFLVFFLGRMVHTVAYLG KLRAPTRSLAYTVAQLPCASMALQIVWEAARHL
Uniprot No.

Target Background

Function
Prostaglandin E synthase (PTGES) is the terminal enzyme in the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. It catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to PGE2 in response to inflammatory stimuli, playing a critical role in inflammation, fever, and pain. PTGES also catalyzes the oxidoreduction of endocannabinoids to prostaglandin glycerol esters and PGG2 to 15-hydroperoxy-PGE2. Additionally, it exhibits low glutathione transferase and glutathione-dependent peroxidase activities towards 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively.
Gene References Into Functions
  1. This study demonstrated that COX-1 and COX-2 expression is low in equine genital carcinomas, while microsomal PGES-1 expression is significantly higher. PMID: 23879794
Database Links
Protein Families
MAPEG family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is Prostaglandin E Synthase (PTGES) and what is its function in equine systems?

Prostaglandin E synthase (PTGES) is an enzyme that catalyzes the conversion of prostaglandin H2 (PGH2) to prostaglandin E2 (PGE2). In equine systems, as in other mammals, PTGES plays a critical role in inflammatory responses, particularly in joint tissues. PGE2 is a key mediator in joint inflammation, contributing to cartilage degradation and pain associated with conditions like arthritis .

Methodologically, researchers studying equine PTGES should note that there are multiple isoforms including membrane-associated PTGES (mPGES-1), cytosolic PTGES (cPGES), and mPGES-2. These isoforms differ in their cellular localization, regulation, and coupling with cyclooxygenase enzymes (COX-1 and COX-2). For experimental purposes, it's essential to identify which specific PTGES isoform is being investigated as their functions may differ in various physiological and pathological contexts.

How can recombinant horse PTGES be expressed and purified for research applications?

While the search results don't provide specific protocols for equine PTGES, the expression methods for human PTGES2 can serve as a methodological template. Based on recombinant protein production practices, E. coli expression systems are commonly used for PTGES production .

For expression and purification of recombinant horse PTGES:

  • Clone the equine PTGES cDNA into a suitable expression vector

  • Transform the construct into an E. coli expression strain

  • Induce protein expression using IPTG or similar inducers

  • Lyse cells and purify using affinity chromatography (commonly His-tag-based purification)

  • Perform further purification using size exclusion or ion exchange chromatography

  • Confirm protein identity and purity using SDS-PAGE and Western blotting

For optimal stability, recombinant PTGES should be stored in buffer containing stabilizing agents such as glycerol and reducing agents like DTT, similar to human PTGES2 . Typically, aliquoting and storing at -80°C will maintain activity and prevent freeze-thaw degradation.

What analytical methods are most suitable for confirming the activity of recombinant horse PTGES?

The enzymatic activity of recombinant horse PTGES can be assessed through:

  • Enzyme activity assays: Measure the conversion of PGH2 to PGE2 using liquid chromatography-mass spectrometry (LC-MS)

  • PGE2 immunoassays: Quantify PGE2 production using PGE2-specific enzyme-linked immunoassays after incubation with PGH2 substrate

  • Radiochemical assays: Utilize radiolabeled substrate to track conversion rates

When establishing activity assays, researchers should consider these methodological parameters:

ParameterRecommended RangeConsiderations
pH7.0-7.4PTGES activity is typically optimal at physiological pH
Temperature37°CReflects physiological conditions
PGH2 concentration1-10 μMSubstrate concentration should not be limiting
Glutathione1-5 mMRequired cofactor for some PTGES isoforms
Incubation time5-30 minutesShould be in linear range of reaction

Validation should include positive controls (known active PTGES preparations) and negative controls (heat-inactivated enzyme or reactions without substrate).

How does interleukin-1β (IL-1β) influence PTGES expression and PGE2 production in equine chondrocytes?

Recombinant equine IL-1β has been demonstrated to significantly affect PGE2 production in equine chondrocytes, suggesting it regulates PTGES expression or activity. In experimental studies, IL-1β at concentrations ≥0.1 ng/ml induced markedly increased PGE2 production in equine articular cartilage explant cultures .

The mechanism appears to involve upregulation of both cyclooxygenase-2 (COX-2) and PTGES expression, creating a coordinated increase in the entire PGE2 production pathway. This IL-1β-mediated increase in PGE2 coincides with cartilage matrix breakdown, specifically proteoglycan release and inhibition of proteoglycan synthesis .

For researchers investigating this relationship, a dose-response experimental design is recommended:

  • Expose equine chondrocytes to graduated concentrations of recombinant equine IL-1β (0.01-500 ng/ml)

  • Measure PGE2 production at regular intervals (e.g., 48-hour intervals)

  • Concurrently analyze PTGES mRNA and protein expression levels

  • Correlate these measurements with markers of cartilage metabolism

Appropriate controls should include untreated chondrocytes and treatment with IL-1 receptor antagonists to confirm specificity.

What role does PGE2 play in modulating matrix metalloproteinase expression in equine cartilage?

Research indicates that PGE2, the product of PTGES activity, modulates matrix metalloproteinase (MMP) expression in equine chondrocytes, though the relationship is complex. Studies have examined how PGE2 affects recombinant equine IL-1β-stimulated expression of matrix metalloproteinases (MMP-1, MMP-3, MMP-13) and tissue inhibitor of matrix metalloproteinase 1 (TIMP-1) .

The methodology for investigating this relationship typically involves:

  • Establishing stationary monolayers of chondrocytes

  • Exposing cultures to graduated concentrations of PGE2 with or without IL-1β

  • Isolating RNA and performing Northern blotting or qPCR to quantify MMP expression

  • Measuring MMP protein levels and enzymatic activity in culture media

  • Using selective COX inhibitors like phenylbutazone to quench endogenous PGE2 synthesis and isolate the effects of exogenous PGE2

This experimental approach allows researchers to distinguish between direct effects of PGE2 on MMP expression and indirect effects mediated through other inflammatory pathways.

How do the four prostaglandin E2 receptor subtypes (EP1-4) mediate the effects of PTGES-derived PGE2 in joint inflammation?

The biological effects of PGE2 produced by PTGES are mediated through four G protein-coupled receptor subtypes (EP1-4), each with distinct signaling pathways. Research on receptor-specific functions has revealed that:

  • EP1 receptor couples to increased intracellular calcium

  • EP2 and EP4 receptors couple to Gαs proteins and increased intracellular cAMP

  • EP3 receptor variants can increase or decrease cAMP or increase calcium

In experimental arthritis models, EP4 receptor-deficient mice showed significantly decreased disease incidence and severity, reduced inflammation (measured by IL-6 and serum amyloid A levels), and reduced bone destruction and cartilage damage . This suggests the EP4 receptor subtype plays a key role in mediating the pro-inflammatory effects of PGE2 in joint disease.

For researchers investigating EP receptor functions in equine systems, selective agonists and antagonists for each receptor subtype can be valuable tools:

ReceptorSelective AgonistsSelective Antagonists
EP1ONO-DI-004, 17-phenyl-PGE2SC-51322, ONO-8711
EP2Butaprost, ONO-AE1-259PF-04418948, ONO-AE3-240
EP3Sulprostone, ONO-AE-248L-826266, ONO-AE3-240
EP4ONO-AE1-329, L-902,688ONO-AE3-208, GW627368X

These tools can help delineate the specific contributions of each receptor to inflammation, pain, and tissue degradation in equine joint disease models.

How does the coordination between cyclooxygenase (COX) enzymes and PTGES affect PGE2 production in equine inflammatory conditions?

The synthesis of PGE2 requires the coordinated action of cyclooxygenase enzymes (COX-1 and COX-2), which convert arachidonic acid to PGH2, and PTGES, which converts PGH2 to PGE2. Research indicates that different PTGES isoforms preferentially couple with different COX enzymes:

  • mPGES-1 predominantly couples with inducible COX-2 in inflammatory conditions

  • cPGES typically couples with constitutive COX-1

  • mPGES-2 can couple with both COX-1 and COX-2

This coordination affects the timing, magnitude, and localization of PGE2 production. In experimental designs studying this relationship, researchers should:

  • Evaluate the expression patterns of COX and PTGES isoforms in equine tissues under normal and inflammatory conditions

  • Use selective COX-1 and COX-2 inhibitors to determine the relative contribution of each pathway

  • Employ siRNA or CRISPR techniques to selectively knockdown specific PTGES isoforms

  • Measure the resulting effects on PGE2 production and downstream inflammatory markers

Understanding this coordination is essential for developing targeted anti-inflammatory strategies for equine joint diseases.

What experimental models are most suitable for studying the role of horse PTGES in joint disease?

Several experimental models can be used to study equine PTGES in joint disease context:

  • In vitro models:

    • Equine chondrocyte monolayer cultures

    • Cartilage explant cultures (near full-thickness articular cartilage, ~50 mg)

    • Three-dimensional chondrocyte cultures in alginate or collagen

    • Co-cultures of chondrocytes with synoviocytes

  • Ex vivo models:

    • Whole joint explant cultures

    • Synovial tissue explants

  • In vivo models:

    • Collagen antibody-induced arthritis (adapted for equine studies)

    • Surgically-induced osteoarthritis

    • Intra-articular injection of inflammatory stimuli (IL-1β, TNF-α)

The cartilage explant model has proven particularly valuable, as it maintains the chondrocyte-matrix relationships. In this model, explants are typically harvested from equine stifle joints, randomized to receive various treatments (e.g., recombinant equine IL-1α or IL-1β at concentrations of 0.1-500 ng/ml), and assessed for:

  • Proteoglycan release using 1,9-dimethylmethylene blue spectrophotometric analysis

  • Proteoglycan synthesis via 35S-sulfate incorporation

  • PGE2 production via specific enzyme-linked immunoassays

Data should be normalized by DNA content to account for variations in cellularity between explants.

What are the current challenges in studying horse PTGES compared to human or murine orthologs?

Researchers face several specific challenges when studying equine PTGES:

  • Reagent availability: Fewer specific antibodies, expression constructs, and detection reagents exist for equine PTGES compared to human or murine orthologs

  • Genetic tools: Limited availability of equine gene editing tools and immortalized cell lines

  • Sequence variations: Understanding functional implications of amino acid differences between equine and human/murine PTGES

  • Isoform characterization: Less comprehensive characterization of equine PTGES isoforms and their tissue-specific expression patterns

To address these challenges, researchers can:

  • Develop and validate cross-reactive tools when equine-specific reagents are unavailable

  • Use heterologous expression systems with equine PTGES cDNA

  • Employ comparative genomics to predict functional conservation

  • Collaborate across equine research institutions to share resources and methodologies

How might selective inhibition of horse PTGES be achieved for experimental and therapeutic purposes?

Selective inhibition of equine PTGES represents both a research tool and potential therapeutic target. Several approaches can be considered:

  • Small molecule inhibitors: Many inhibitors developed against human PTGES may have cross-reactivity with equine orthologs due to conserved active sites

  • Genetic approaches:

    • siRNA or antisense oligonucleotides targeting PTGES mRNA

    • CRISPR-Cas9 genetic editing in experimental systems

  • Protein-based approaches:

    • Blocking antibodies against PTGES

    • Dominant-negative PTGES mutants

When developing inhibition strategies, researchers should consider:

  • The specificity for particular PTGES isoforms

  • Potential off-target effects on other prostaglandin synthases

  • The consequences of shifting arachidonic acid metabolism to other pathways

  • Pharmacokinetic and pharmacodynamic properties for in vivo applications

Validation of inhibition should include measurement of PGE2 levels and functional outcomes in inflammation models. The goal of selective PTGES inhibition is to potentially avoid the adverse effects associated with non-selective COX inhibition, which affects all prostanoid production.

What control conditions should be included when studying the effects of recombinant horse PTGES in experimental systems?

Robust experimental design for equine PTGES studies should include these controls:

  • Enzyme activity controls:

    • Heat-inactivated recombinant PTGES (negative control)

    • Known active PTGES preparation (positive control)

    • Reactions without substrate or essential cofactors

  • Expression system controls:

    • Empty vector-transformed expression host

    • Host cells expressing an irrelevant protein using the same expression system

  • Cellular response controls:

    • When studying PGE2 effects: EP receptor antagonists to confirm receptor-mediated effects

    • COX inhibitors to block endogenous PGE2 production when testing exogenous PGE2

    • IL-1 receptor antagonists when using IL-1β stimulation

  • Normalization controls:

    • Housekeeping gene expression for qPCR

    • Total DNA content for normalizing cellular responses

    • Internal standards for mass spectrometry

Implementing these controls helps distinguish specific PTGES-mediated effects from non-specific experimental artifacts and provides quantitative benchmarks for comparing results across experiments.

How should researchers interpret contradictory data regarding PTGES function in different equine tissue contexts?

When facing contradictory results about PTGES function across different equine tissues or experimental conditions, researchers should systematically consider:

  • PTGES isoform differences: Different isoforms may predominate in different tissues or under different conditions

  • Context-dependent signaling: EP receptor expression profiles may vary between tissues, leading to different responses to the same PGE2 concentration

  • Experimental variables:

    • Acute vs. chronic exposure models

    • In vitro vs. ex vivo vs. in vivo systems

    • Healthy vs. diseased/inflamed tissue

  • Methodological differences:

    • Timing of measurements

    • Sensitivity and specificity of detection methods

    • Sample preparation techniques

Resolution approaches include:

  • Direct side-by-side comparison using standardized methods

  • Sequential inhibition or activation of specific pathway components

  • Comprehensive time-course studies to capture dynamic responses

  • Multi-parameter analysis examining multiple outcomes simultaneously

The complexity of prostaglandin biology means that seemingly contradictory results may actually reflect the nuanced regulation of these pathways in different physiological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.