Recombinant Horse Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order to facilitate preferential development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Equus caballus (Horse)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links

UniGene: Eca.16234

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Suppressor of Tumorigenicity 7 (ST7) protein and what is its primary function?

Suppressor of Tumorigenicity 7 (ST7) is a protein encoded by the ST7 gene located on chromosome region 7q31.1-q31.2 in humans. It functions primarily as a tumor suppressor through the regulation of genes involved in maintaining cellular structure and in oncogenic pathways . The protein mediates tumor suppression by modulating the expression of genes critical for cell cycle regulation and structural integrity. Research indicates that ST7 plays a significant role in cancer development and progression, with its dysregulation potentially contributing to tumorigenesis across various cancer types .

What is the subcellular localization of ST7 protein in mammalian cells?

Studies using fluorescently tagged ST7 proteins have demonstrated predominantly cytosolic expression in multiple cancer cell lines, including HCT-116 (colorectal cancer), MCF-7 (breast cancer), and PC-3 (prostate cancer) . Importantly, translocation of ST7 from the cytoplasm to the nucleus has not been observed under various experimental conditions, suggesting that ST7 exerts its tumor suppressive functions through cytoplasmic mechanisms rather than direct transcriptional regulation . This cytosolic localization provides valuable insight into potential protein-protein interactions and signaling pathways that ST7 may influence.

What expression systems are recommended for producing recombinant ST7 protein?

For recombinant ST7 production, Escherichia coli expression systems have been successfully employed, particularly for full-length protein production . The methodology typically involves:

  • Cloning the full-length ST7 cDNA into an appropriate expression vector (such as pET-based vectors)

  • Adding an N-terminal His-tag for purification purposes

  • Transforming expression-competent E. coli strains

  • Inducing protein expression under optimized conditions

  • Protein extraction and purification via affinity chromatography

While E. coli systems are widely used, researchers investigating post-translational modifications or protein-protein interactions may benefit from eukaryotic expression systems such as insect cells or mammalian cell lines, although these may yield lower protein quantities .

How can ST7 expression be analyzed during different stages of the cell cycle?

To analyze ST7 expression throughout the cell cycle, researchers can employ cell cycle synchronization methods combined with expression analysis techniques . A methodological approach includes:

  • Synchronizing cells using:

    • Serum starvation (G0/G1 phase)

    • Double thymidine block (G1/S boundary)

    • Nocodazole treatment (G2/M phase)

  • Confirming synchronization via flow cytometry with propidium iodide staining

  • Harvesting cells at specific time points after release

  • Analyzing ST7 expression through:

    • RT-qPCR for mRNA quantification

    • Western blotting for protein level detection

    • Immunofluorescence microscopy for subcellular localization

This approach has revealed that ST7 is overexpressed in arrested cells and its expression decreases when cells re-enter the cell division cycle, a pattern similar to SERPINE1 expression . This correlation suggests potential functional relationships between these proteins in cell cycle regulation.

What are the recommended storage conditions for maintaining recombinant ST7 protein stability?

Optimal storage conditions for recombinant ST7 protein are critical for maintaining its structural integrity and biological activity . Based on established protocols:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CSuitable for up to one week
Long-term storage-20°C or -80°CAliquot to minimize freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerol, pH 8.0Optimized for protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for long-term storage
HandlingBrief centrifugation before openingBrings contents to the bottom of the vial

Importantly, repeated freeze-thaw cycles should be avoided as they significantly reduce protein activity and stability . Working aliquots should be prepared during initial reconstitution to minimize the need for multiple freeze-thaw cycles.

How does ST7 contribute to tumor suppression at the molecular level?

The molecular mechanisms underlying ST7's tumor suppressive functions involve complex regulatory networks . Research indicates that ST7 influences:

  • Cell cycle regulation: ST7 expression correlates with cell cycle arrest, suggesting a role in controlling proliferation. Its expression pattern mirrors that of SERPINE1, with both being overexpressed in arrested cells and diminished during cell division .

  • Gene expression modulation: ST7 regulates genes involved in:

    • Cellular structure maintenance

    • Extracellular matrix organization

    • Migration and invasion

    • Apoptotic pathways

  • Interaction with other tumor suppressor pathways: ST7 may function in concert with other tumor suppressors, potentially affecting the nonsense-mediated mRNA decay (NMD) pathway that can degrade mRNAs encoding truncated but still functional tumor suppressor proteins .

The cytoplasmic localization of ST7 suggests that rather than acting as a direct transcriptional regulator, it more likely influences signaling pathways or protein-protein interactions that ultimately affect cellular phenotypes associated with cancer progression .

What are the best approaches for studying ST7 protein-protein interactions?

To investigate ST7 protein-protein interactions, researchers should consider multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-ST7 antibodies or antibodies against tagged versions (His, GFP, YFP, V5) of ST7

    • Perform in physiologically relevant cell lines (e.g., HCT-116, MCF-7, PC-3)

    • Validate interactions through reverse Co-IP experiments

  • Proximity-based labeling techniques:

    • BioID or TurboID fusions with ST7 to identify proximal proteins

    • APEX2-based proximity labeling for temporal resolution

    • Analysis of labeled proteins via mass spectrometry

  • Fluorescence-based interaction assays:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Leverage existing GFP/YFP-tagged ST7 constructs

  • Yeast two-hybrid screening:

    • Use domain-specific baits to identify interaction partners

    • Validate hits in mammalian systems

When designing these experiments, researchers should consider that ST7 is predominantly cytoplasmic and does not appear to translocate to the nucleus, focusing on potential cytoplasmic interaction partners involved in signaling pathways relevant to tumor suppression .

How does ST7 expression correlate with clinical outcomes in different cancer types?

The relationship between ST7 expression and clinical outcomes across cancer types represents a complex area of investigation. While comprehensive clinical data specifically for ST7 is still emerging, research suggests several notable patterns:

  • Expression patterns:

    • Decreased ST7 expression is observed in various tumor tissues compared to normal tissues

    • Loss of heterozygosity at the ST7 locus (7q31.1-q31.2) is common in several malignancies

  • Correlation with disease progression:

    • Lower ST7 expression typically correlates with more advanced disease stages

    • ST7 downregulation may be associated with increased metastatic potential

  • Cell-specific effects:

    • ST7's impact appears to be cell-type dependent

    • Its regulatory networks likely interact with tissue-specific factors

To properly investigate these correlations, researchers should employ:

  • Tissue microarrays for protein expression analysis

  • RNA-seq for transcriptomic profiling

  • Integration with patient clinical data

  • Survival analyses (Kaplan-Meier) stratified by ST7 expression levels

The mechanistic basis for these clinical correlations may involve ST7's role in regulating genes related to cellular structure and oncogenic pathways, as demonstrated in studies of cancer cell lines .

What are common challenges in detecting endogenous ST7 protein expression?

Researchers frequently encounter several challenges when attempting to detect endogenous ST7 protein:

  • Low abundance: ST7 is often expressed at relatively low levels in many cell types, making detection difficult without sensitive methods.

  • Antibody specificity issues:

    • Commercial antibodies may show cross-reactivity with related proteins

    • Validation through knockout or knockdown controls is essential

    • Western blot may require extended exposure times or enhanced chemiluminescence

  • Sample preparation considerations:

    • Optimal lysis buffers should contain appropriate detergents (RIPA or NP-40-based)

    • Protease inhibitors are crucial to prevent degradation

    • Phosphatase inhibitors may be necessary if studying post-translational modifications

  • Detection method optimization:

    • Immunoprecipitation before Western blotting may enhance detection

    • Fluorescent secondary antibodies can provide better sensitivity than HRP-based detection

    • Consider using recombinant tagged ST7 as a positive control

For improved detection, researchers may benefit from using cell cycle synchronization, as ST7 expression is higher in arrested cells compared to actively dividing populations .

How can researchers differentiate between direct and indirect effects of ST7 in functional studies?

Distinguishing direct from indirect effects of ST7 protein requires sophisticated experimental approaches:

  • Rescue experiments:

    • Generate ST7 knockout cell lines

    • Reintroduce wild-type or mutant ST7 variants

    • Compare phenotypic and molecular outcomes

    • This approach can help identify which effects are directly attributable to ST7 function

  • Domain-specific mutants:

    • Create point mutations or domain deletions in ST7

    • Assess which functional aspects are compromised

    • Map structure-function relationships

  • Temporal analysis:

    • Use inducible expression systems for time-course studies

    • Monitor immediate early changes (likely direct effects)

    • Compare with later changes (potentially indirect consequences)

    • Employ RNA-seq and proteomics at multiple time points

  • Pathway inhibition studies:

    • Combine ST7 modulation with inhibitors of suspected downstream pathways

    • Assess whether phenotypic effects of ST7 are attenuated

  • Direct binding assays:

    • In vitro binding studies with purified components

    • Surface plasmon resonance or microscale thermophoresis

    • Identification of direct binding partners versus secondary interactors

These approaches can help researchers build a hierarchical model of ST7-mediated effects, distinguishing primary from secondary consequences of ST7 activity in cellular contexts .

What controls should be included when studying ST7 in relation to nonsense-mediated mRNA decay (NMD)?

  • Positive controls for NMD activity:

    • Include well-established NMD substrate transcripts (e.g., GADD45B, GAS5)

    • Monitor expression of NMD factors (UPF1, UPF2, SMG1, SMG9) at both mRNA and protein levels

    • Use reporter constructs containing premature termination codons (PTCs)

  • Genetic controls:

    • Generate knockout/knockdown cells for ST7 alongside NMD factors (e.g., SMG7, UPF1)

    • Create rescue cell lines reintroducing the wild-type gene

    • Include isogenic cell lines differing only in the gene of interest

  • Pharmacological controls:

    • Use established NMD inhibitors (e.g., SMG1 inhibitors) as comparative controls

    • Include treatment time courses to distinguish acute from chronic effects

    • Employ appropriate vehicle controls

  • Transcript analysis controls:

    • Measure multiple housekeeping genes for normalization

    • Include intron retention analysis to control for splicing defects

    • Perform degradation rate measurements using transcription inhibitors

  • Protein turnover controls:

    • Monitor protein half-life with cycloheximide chase experiments

    • Use proteasome inhibitors to control for protein degradation effects

These controls help distinguish ST7-specific effects from general consequences of NMD perturbation, which is particularly important given that NMD has shown both tumor-suppressive and pro-tumorigenic roles depending on the model system .

What are promising approaches for targeting ST7 pathways in cancer therapeutics?

Several innovative approaches show potential for targeting ST7-related pathways for therapeutic purposes:

  • Restoration of ST7 function:

    • Development of CRISPR/Cas9-based gene therapy to correct ST7 mutations

    • Creation of small molecules that mimic ST7 function in deficient cells

    • Design of mRNA delivery systems to restore ST7 expression

  • Targeting downstream effectors:

    • Identification of critical ST7-regulated genes (e.g., SERPINE1, MMP9)

    • Development of inhibitors specific to these effector molecules

    • Combination approaches targeting multiple effectors simultaneously

  • NMD modulation strategies:

    • Development of selective NMD inhibitors that preserve truncated tumor suppressor functions

    • Targeted degradation of NMD factors in cancer contexts

    • Screening for synthetic lethal interactions with ST7 pathway alterations

  • Biomarker development:

    • Establishing ST7 expression or mutation profiles as predictive biomarkers

    • Creating companion diagnostics for ST7-targeted therapies

    • Identification of patient subgroups most likely to benefit from ST7-related interventions

Early research suggests that NMD inhibition, which can affect ST7 and other tumor suppressor proteins, significantly compromises the oncogenic phenotype in some cancer models, indicating promising therapeutic potential .

How might cross-species comparative studies of ST7 advance our understanding of its function?

Cross-species comparative analysis of ST7 represents a valuable approach to understanding evolutionary conserved functions and species-specific adaptations:

  • Sequence conservation analysis:

    • Compare ST7 sequences across mammals (human, horse, sheep, etc.)

    • Identify highly conserved domains likely essential for function

    • Map species-specific variations that might relate to specialized functions

    • The high sequence similarity between human and horse ST7 proteins suggests strongly conserved functional domains

  • Functional conservation studies:

    • Determine whether ST7 from different species can rescue phenotypes in human cell models

    • Assess whether regulatory mechanisms are conserved across species

    • Compare tissue-specific expression patterns across evolutionary lineages

  • Animal model development:

    • Generate transgenic models expressing species-specific ST7 variants

    • Create conditional knockout models across different species

    • Develop humanized animal models for therapeutic testing

  • Structural biology approaches:

    • Crystallize ST7 proteins from different species

    • Compare three-dimensional structures to identify conserved functional motifs

    • Use structural information to guide targeted mutagenesis studies

These comparative approaches can provide insights into fundamental ST7 functions while highlighting species-specific adaptations that may inform therapeutic strategies for human diseases.

What novel experimental models would advance our understanding of ST7 biology?

Developing innovative experimental models would significantly enhance our understanding of ST7 biology:

  • Organoid systems:

    • Establish 3D organoid cultures from various tissues

    • Create ST7 knockout/knockin organoids via CRISPR/Cas9

    • Study tissue-specific functions and cancer progression in more physiologically relevant contexts

  • Patient-derived xenografts (PDXs):

    • Develop PDX libraries with characterized ST7 status

    • Test ST7-targeted therapeutic approaches

    • Correlate ST7 expression/mutation with treatment response

  • Advanced genetic models:

    • Generate conditional and inducible ST7 knockout animals

    • Create reporter strains for real-time visualization of ST7 expression

    • Develop tissue-specific ST7 knockout models to address compartment-specific functions

  • Synthetic biology approaches:

    • Engineer artificial regulatory networks incorporating ST7

    • Create optogenetic systems for temporal control of ST7 activity

    • Develop biosensors to monitor ST7-related signaling events in real-time

  • Multi-omics integration models:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply machine learning algorithms to identify novel ST7 functions

    • Create predictive models of ST7's impact on cellular networks

These advanced models would move beyond the limitations of current cell line-based studies, allowing researchers to address context-dependent functions of ST7 in more complex biological systems that better recapitulate human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.