Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (AGPAT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for prioritized development.
Synonyms
AGPAT1; G15; 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1; 1-AGP acyltransferase 1; 1-AGPAT 1; Lysophosphatidic acid acyltransferase alpha; LPAAT-alpha; Protein G15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-283
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
FCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEV RGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIF IDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIV PIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREIS TDGRGGGDYLKKPGGGG
Uniprot No.

Target Background

Function
This recombinant human 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (AGPAT1) catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by acylating the sn-2 position of the glycerol backbone.
Gene References Into Functions
  1. A study reported on the differential expression of AGPAT1 in human monocytes and macrophages and its impact on platelet-activating factor production. PMID: 16571775
  2. Research suggests that motifs II and III of AGPAT1 are involved in lysophosphatidic acid binding, while motifs I and IV are involved in acyl-CoA binding. PMID: 17707131
Database Links

HGNC: 324

OMIM: 603099

KEGG: hsa:10554

STRING: 9606.ENSP00000337463

UniGene: Hs.409230

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed in adipose tissue and at high levels in testis and pancreas. Expressed at lower levels in tissues such as heart, brain, placenta, kidney, lung, spleen, thymus, prostate, ovary, intestine, colon, leukocyte and liver.

Q&A

What is the biochemical function of AGPAT1?

AGPAT1 (1-acyl-sn-glycerol-3-phosphate acyltransferase alpha) is an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) by catalyzing the acylation of LPA at the sn-2 position. This reaction represents the second step in the de novo phospholipid biosynthetic pathway. Both LPA and PA are critical phospholipids involved in cellular signal transduction and lipid biosynthesis . The enzyme is localized to the endoplasmic reticulum and plays a key role in glycerophospholipid and triacylglycerol biosynthesis .

How does AGPAT1 compare structurally and functionally to other AGPAT isoforms?

AGPAT1 shares significant structural similarities with other AGPAT isoforms, particularly AGPAT2. Protein homology modeling studies comparing AGPAT1 and AGPAT2 with glycerol-3-phosphate acyltransferase 1 (GPAT1) reveal similar tertiary protein structures . This structural similarity aligns with their comparable substrate specificities for lysophosphatidic acid and acyl-CoA .

Despite these similarities, functional studies demonstrate that different AGPAT isoforms have distinct physiological roles. For instance, while AGPAT2 has been clearly linked to adipose tissue development (with mutations causing congenital generalized lipodystrophy), the physiological role of AGPAT1 has been less defined until recent studies with knockout models . When co-expressed, both AGPAT1 and AGPAT2 co-localize to the endoplasmic reticulum, suggesting potential functional redundancy in certain cellular contexts .

What methods are commonly used to clone and express recombinant human AGPAT1?

The following methodological approach is commonly used for cloning and expression of recombinant human AGPAT1:

  • cDNA synthesis and amplification:

    • Isolate total RNA from human tissue samples

    • Synthesize first-strand cDNA using reverse transcriptase (e.g., MMLV-RT)

    • Amplify AGPAT1 cDNA using specific primers:

      • Forward primer: 5′-GGTACTCGCAACGACAATGG-3′

      • Reverse primer: 5′-TTGGTGTTGTAGAAGGAGGAGAAG-3′

  • Vector construction:

    • Clone the amplified cDNA into an expression vector (e.g., pcDNA3.1)

    • For epitope tagging, primers can be designed to incorporate tags (e.g., V5 epitope)

    • Confirm correct insertion and orientation by restriction enzyme digestion and sequencing

  • Expression systems:

    • In vitro: Coupled transcription and translation systems (e.g., Reticulocyte Lysate System)

    • Cell-based: Transfection into HEK-293 cells or similar mammalian expression systems

    • Adenoviral: For in vivo studies, recombinant adenoviral vectors can be generated by subcloning into shuttle vectors (e.g., pShuttle-CMV)

  • Protein purification:

    • Express with appropriate affinity tags for purification

    • Perform cell lysis under conditions that maintain enzyme activity

    • Use column chromatography techniques suitable for membrane-associated proteins

How can AGPAT1 enzymatic activity be reliably measured in recombinant systems?

A reliable protocol for measuring AGPAT1 enzymatic activity includes:

  • Reaction components:

    • Purified or cell lysate-containing recombinant AGPAT1

    • Lysophosphatidic acid (LPA) substrate (typically 50-100 μM)

    • Acyl-CoA donor (usually 60 μM)

    • Radiolabeled substrates for quantification (e.g., [14C]-labeled acyl-CoA)

    • Appropriate buffer (generally containing Mg2+ as a cofactor)

  • Reaction conditions:

    • Incubate at 37°C for 10-15 minutes

    • Terminate reaction by adding chloroform:methanol (2:1)

    • Extract lipids using Bligh and Dyer method

    • Separate lipid products by thin-layer chromatography

    • Quantify by scintillation counting of radiolabeled products

  • Controls and validation:

    • Include enzyme-free negative controls

    • Use heat-inactivated enzyme as additional control

    • Verify product formation by mass spectrometry

    • Include known AGPAT inhibitors to confirm specificity

  • Substrate specificity assessment:

    • Test various lysophospholipids (lysophosphatidylcholine, lysophosphatidylethanolamine, lysophosphatidylserine, lysophosphatidylglycerol, and lysophosphatidylinositol) to determine substrate preferences

    • Vary acyl-CoA chain length and saturation to evaluate acyl donor specificity

This methodology enables reliable quantification of AGPAT1 activity and comparison between wild-type and mutant enzymes or between different AGPAT isoforms.

What approaches are effective for studying AGPAT1 expression patterns across different tissues?

Multiple complementary approaches are recommended for comprehensive analysis of AGPAT1 expression patterns:

  • Quantitative PCR (qPCR):

    • Design AGPAT1-specific primers and probes:

      • Forward: 5′-TGACAACGGATGGATGTTATGC-3′

      • Reverse: 5′-GACAAGCCTTGACCATAGCTCTCT-3′

      • Probe: Fam-labeled TTGGCCAGGTTCATG

    • Use reference genes for normalization

    • Apply on commercial human tissue cDNA panels or custom tissue libraries

  • Immunohistochemistry (IHC):

    • Use validated antibodies (e.g., HPA073355, Atlas Antibodies AB)

    • Apply automated quantification using image analysis software (e.g., QuPath)

    • Establish scoring criteria (example from AGPAT1 colorectal studies):

      • Weak staining: 0.05-0.14

      • Moderate staining: 0.15-0.29

      • Strong staining: >0.30

  • Proteomics approaches:

    • LC-MS/MS analysis of tissue samples

    • Process tissues using filter-aided sample preparation methods

    • Quantify using total protein approach with raw spectral intensities

  • Western blotting:

    • Use tissue-specific lysates

    • Include subcellular fractionation to confirm localization

    • Quantify relative expression levels

By combining these approaches, researchers can develop a comprehensive understanding of AGPAT1 expression patterns across tissues and in different disease states.

What are effective protocols for generating and validating AGPAT1 knockout models?

Based on successful AGPAT1 knockout studies, the following protocol is recommended:

  • Knockout strategy design:

    • Target all coding exons (exons 2-7 for complete functional knockout)

    • Design homologous recombination constructs with appropriate selection markers

    • Consider conditional knockout approaches if complete knockout causes severe phenotypes

  • Validation of knockout:

    • Genotyping PCR: Design primers flanking the deleted region

    • Transcript analysis: Perform RT-qPCR to confirm absence of AGPAT1 mRNA in multiple tissues (liver, testis, adipose tissues)

    • Protein analysis: Western blot to confirm absence of AGPAT1 protein

    • Enzymatic activity: Measure AGPAT activity in tissue homogenates to confirm functional deletion

  • Phenotypic characterization:

    • Monitor growth, development, and viability

    • Assess tissue-specific effects (special attention to adipose tissue, liver, and reproductive organs)

    • Analyze metabolic parameters:

      • Energy expenditure and respiratory exchange ratio

      • Glucose homeostasis

      • Lipid profiles

      • Locomotor activity

  • Molecular compensation assessment:

    • Measure expression levels of other AGPAT isoforms to detect compensatory upregulation

    • Evaluate changes in related enzymes in the glycerolipid synthesis pathway

    • Consider tissue-specific changes in phospholipid and triacylglycerol levels

Successful AGPAT1 knockout mice have been generated using this approach, revealing important insights into metabolic, reproductive, and neurologic functions of this enzyme .

How can AGPAT1 be utilized as a biomarker in inflammatory bowel disease research?

Recent proteomic studies have identified AGPAT1 as a promising biomarker for distinguishing ulcerative colitis with concomitant primary sclerosing cholangitis (PSC-UC) from classical ulcerative colitis (UC). The following methodological approach is recommended for AGPAT1 biomarker studies:

  • Sample collection and processing:

    • Collect formalin-fixed paraffin-embedded (FFPE) proximal colon biopsies

    • Process samples using multienzyme digestion filter-aided sample preparation (FASP)

    • Perform peptide analysis by liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Quantification methods:

    • Apply "total protein approach" using raw spectral intensities from MaxQuant output

    • Use immunohistochemistry with validated AGPAT1 antibodies for validation

    • Implement automated image analysis for objective quantification

  • Validation strategy:

    • Use a two-step approach with discovery and validation cohorts

    • Conduct meta-analysis of combined datasets

    • Control for potential confounding factors (age, medication use)

  • Results interpretation:

    • AGPAT1 levels are significantly higher in PSC-UC compared to UC

    • Surface epithelial cells show more intense staining than crypt epithelial cells

    • PSC-UC samples have a higher proportion of strong AGPAT1 staining

This approach has successfully identified AGPAT1 as a discriminating biomarker between PSC-UC and UC, with potential implications for diagnosis, surveillance, and understanding the pathophysiology of these conditions.

What approaches are effective for investigating the functional redundancy between AGPAT1 and AGPAT2?

To effectively investigate functional redundancy between AGPAT1 and AGPAT2, the following methodological approaches are recommended:

  • Co-expression and localization studies:

    • Express epitope-tagged AGPAT1 and AGPAT2 in cell models

    • Perform subcellular fractionation and immunofluorescence to confirm co-localization

    • Use proximity ligation assays to determine if they form complexes

  • Cross-complementation studies:

    • Overexpress AGPAT1 in AGPAT2-deficient models (or vice versa)

    • Assess restoration of lipid metabolism phenotypes

    • Example: Adenoviral expression of AGPAT1 in Agpat2-/- mouse livers failed to ameliorate hepatic steatosis, suggesting limited functional redundancy in this context

  • Substrate specificity comparison:

    • Perform detailed enzymatic characterization with various lysophospholipid substrates

    • Compare kinetic parameters (Km, Vmax) for different substrates

    • Results indicate similar substrate specificities for LPA and acyl-CoA between AGPAT1 and AGPAT2

  • Protein structure analysis:

    • Conduct homology modeling with GPAT1 as a structural template

    • Compare active site architecture and substrate binding pockets

    • Findings show similar tertiary protein structures between AGPAT1 and AGPAT2

  • Tissue-specific expression patterns:

    • Analyze expression profiles across different tissues

    • Identify tissues with preferential expression of each isoform

    • Correlate with functional requirements in those tissues

This multilevel approach provides comprehensive insights into the extent of functional redundancy between these enzymes and helps explain why deficiencies in one isoform may not be fully compensated by the other.

How can researchers effectively study the role of AGPAT1 in neurologic function?

Recent studies have revealed unexpected roles for AGPAT1 in neurologic function. The following methodological approach is recommended for investigating these aspects:

  • Neuronal culture systems:

    • Isolate hippocampal neurons from AGPAT1 knockout and wild-type littermate pups

    • Culture neurons under standardized conditions for 4-5 days

    • Assess parameters such as:

      • Neuronal morphology and dendritic branching

      • Synaptic protein expression

      • Glucose uptake using [3H]-2-deoxyglucose

  • Behavioral phenotyping:

    • Conduct comprehensive behavioral testing of Agpat1-/- mice, including:

      • Locomotor activity (horizontal and vertical movements)

      • Anxiety and depression-like behaviors

      • Cognitive assessment (learning and memory tasks)

      • Social interaction tests

    • Results indicate significantly increased locomotor activity (horizontal: 97-131%; vertical: 141-392%) in Agpat1-/- mice compared to wild-type, particularly during nighttime

  • Metabolic parameters in neural tissues:

    • Measure energy expenditure and respiratory exchange ratio

    • Analyze brain-specific lipid composition

    • Assess glucose metabolism in neural tissues

  • Molecular mechanisms:

    • Investigate membrane phospholipid composition in neurons

    • Evaluate changes in signaling pathways dependent on phosphatidic acid

    • Assess mitochondrial function in neural tissues

This integrated approach enables researchers to connect the biochemical function of AGPAT1 to its neurological effects, offering insights into how phospholipid metabolism influences brain function and behavior.

How can researchers overcome the challenges of purifying functional recombinant AGPAT1?

AGPAT1 purification presents challenges due to its membrane association and potential instability. The following optimized protocol addresses these issues:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO) generally yield functional enzyme

    • Insect cell systems (Sf9, Hi5) provide higher yields while maintaining activity

    • Avoid bacterial expression systems which may not properly fold this eukaryotic membrane protein

  • Solubilization optimization:

    • Test a panel of detergents for optimal solubilization:

      • Mild non-ionic detergents (0.5-1% DDM, 1% Triton X-100)

      • Zwitterionic detergents (0.5-1% CHAPS)

      • Include 20% glycerol as a stabilizing agent

    • Avoid harsh detergents like SDS that denature the enzyme

  • Affinity tag strategies:

    • N-terminal tags are preferred (C-terminal tags may interfere with membrane association)

    • Recommended tags: His6, FLAG, or V5 epitope

    • Consider TEV protease cleavage sites for tag removal after purification

  • Stabilization approaches:

    • Include phospholipids in purification buffers (0.02-0.05% brain total lipid extract)

    • Maintain 4°C throughout purification

    • Add protease inhibitor cocktails

    • Consider nanodiscs or liposome reconstitution for final preparation

  • Activity verification:

    • Test enzymatic activity at each purification step

    • Optimize buffer conditions (pH, salt concentration, divalent cations)

    • Implement quality control by size-exclusion chromatography

Following this protocol enables the purification of functional AGPAT1 enzyme suitable for structural studies, enzymatic characterization, and inhibitor screening.

What strategies can address conflicting data regarding AGPAT1 function between in vitro and in vivo studies?

Resolving discrepancies between in vitro and in vivo findings requires a systematic approach:

  • Contextual analysis of experimental conditions:

    • Compare substrate concentrations between studies (physiological vs. non-physiological)

    • Examine differences in expression levels (overexpression vs. endogenous)

    • Assess cellular context (cell types, culture conditions, disease models)

  • Complementary methodological approaches:

    • Combine in vitro enzymatic assays with cellular lipid profiling

    • Use isotope labeling to track metabolic flux through AGPAT1

    • Implement CRISPR-Cas9 gene editing for precise manipulation of endogenous AGPAT1

  • Addressing compensatory mechanisms:

    • Evaluate expression changes in related enzymes (other AGPAT isoforms, GPAT, PAP enzymes)

    • Consider acute vs. chronic models (inducible knockout systems)

    • Example: While AGPAT1 can compensate for AGPAT2 in vitro, overexpression of AGPAT1 failed to rescue the hepatic steatosis phenotype in Agpat2-/- mice

  • Tissue-specific considerations:

    • Examine tissue-specific expression patterns and substrate availability

    • Implement tissue-specific knockout models

    • Data suggest minimal role of both AGPAT1 and AGPAT2 in liver lipogenesis, with hepatic steatosis in knockout models primarily attributed to insulin resistance and loss of adipose tissue

  • Temporal dynamics:

    • Consider developmental timing effects

    • Implement time-course studies to capture dynamic changes

    • Examine acute vs. chronic effects

This integrated approach helps reconcile seemingly contradictory findings by identifying the specific contexts in which AGPAT1 functions differently, providing a more complete understanding of its biological roles.

How can researchers effectively analyze the complex metabolic phenotypes resulting from AGPAT1 manipulation?

Analysis of complex metabolic phenotypes resulting from AGPAT1 manipulation requires a systematic, multi-level approach:

  • Comprehensive metabolic phenotyping:

    • Energy balance parameters:

      • Food intake and body weight tracking

      • Indirect calorimetry for energy expenditure measurement

      • Respiratory exchange ratio (RER) to assess substrate utilization

      • Physical activity monitoring (horizontal and vertical movements)

    • Glucose homeostasis:

      • Glucose tolerance tests

      • Insulin tolerance tests

      • Hyperinsulinemic-euglycemic clamps for insulin sensitivity

      • Tissue-specific glucose uptake using radiolabeled glucose

    • Lipid metabolism:

      • Serum lipid profiles (triglycerides, cholesterol, free fatty acids)

      • Tissue lipid content analysis by mass spectrometry

      • Hepatic and adipose lipogenesis rate measurements

      • Fatty acid oxidation assessments

  • Tissue-specific analysis protocol:

    • Liver:

      • Histological assessment for steatosis

      • Gene expression analysis of lipogenic and lipolytic pathways

      • Mitochondrial function assessment (oxidative phosphorylation, β-oxidation)

      • Reactive oxygen species measurement

    • Adipose tissue:

      • Depot-specific mass and morphology

      • Adipocyte size distribution

      • Lipolysis and lipogenesis rates

      • Inflammatory marker assessment

    • Muscle:

      • Intramyocellular lipid content

      • Insulin signaling pathway analysis

      • Mitochondrial respiration measurement

      • Exercise capacity testing

  • Integrated multi-omics approach:

    • Transcriptomics to identify gene expression changes

    • Proteomics for protein abundance and post-translational modifications

    • Lipidomics to characterize comprehensive lipid profile changes

    • Metabolomics to capture broader metabolic alterations

    • Network analysis to identify altered pathways

  • Temporal considerations:

    • Age-dependent phenotyping

    • Developmental stage analysis

    • Circadian rhythm effects

This comprehensive approach enables researchers to untangle the complex metabolic effects of AGPAT1 manipulation, distinguishing primary effects from secondary adaptations and identifying key regulatory nodes in metabolic networks.

What are promising approaches for investigating AGPAT1 as a therapeutic target in disease?

Emerging evidence suggests AGPAT1 may be a promising therapeutic target in several disease contexts. The following research approaches are recommended:

  • High-throughput screening for AGPAT1 inhibitors:

    • Develop fluorescence-based enzymatic assays suitable for 384-well format

    • Screen compound libraries (natural products, FDA-approved drugs, focused lipid-modifying compounds)

    • Perform counter-screening against other AGPAT isoforms to identify selective inhibitors

    • Validate hits with secondary assays using radiolabeled substrates

  • Structure-based drug design:

    • Generate high-resolution structures through X-ray crystallography or cryo-EM

    • Alternatively, use refined homology models based on related enzymes

    • Perform in silico docking and virtual screening

    • Design compounds targeting the active site or allosteric regulatory sites

  • Disease-specific evaluation:

    • Inflammatory bowel disease:

      • Test AGPAT1 modulators in animal models of colitis

      • Evaluate effects on inflammation markers and tissue damage

      • Assess efficacy in distinguishing PSC-UC from UC

    • Metabolic disorders:

      • Evaluate effects on glucose homeostasis and insulin sensitivity

      • Assess impact on hepatic steatosis and adipose tissue function

      • Test in models of lipodystrophy and diabetes

    • Neurological conditions:

      • Based on neurological phenotypes in knockout models

      • Assess effects on behavior, learning, and memory

      • Evaluate potential neuroprotective effects

  • Therapeutic delivery strategies:

    • Tissue-specific targeting approaches

    • Lipid nanoparticle formulations for liver targeting

    • Adenoviral or AAV-based gene therapy for genetic disorders

This systematic approach to therapeutic development provides a pathway from target identification through preclinical validation, with consideration of disease-specific mechanisms and delivery challenges.

How can researchers effectively investigate the role of AGPAT1 in phospholipid remodeling and membrane dynamics?

To investigate AGPAT1's role in phospholipid remodeling and membrane dynamics, implement the following research strategy:

  • Advanced lipidomic analysis:

    • Employ high-resolution LC-MS/MS to quantify phospholipid species

    • Use stable isotope labeling to track phospholipid flux:

      • [13C]-glycerol to monitor de novo synthesis

      • [13C]-fatty acids to track acyl chain remodeling

    • Perform pulse-chase experiments to determine turnover rates

    • Compare wild-type vs. AGPAT1-manipulated cells/tissues

  • Membrane biophysical characterization:

    • Analyze membrane fluidity using fluorescence anisotropy

    • Assess membrane order with laurdan generalized polarization

    • Examine lipid raft formation and composition

    • Measure membrane curvature and elasticity

  • Subcellular fractionation and organelle-specific analysis:

    • Isolate ER, Golgi, mitochondria, and plasma membrane fractions

    • Compare phospholipid profiles across compartments

    • Track phospholipid movement between organelles

    • Examine effects of AGPAT1 manipulation on organelle-specific lipid composition

  • Functional membrane protein analysis:

    • Assess activity of membrane proteins in AGPAT1-modulated conditions

    • Study effects on receptor clustering and signaling platforms

    • Examine ion channel function and membrane potential

    • Investigate effects on membrane fusion and fission events

  • Advanced imaging approaches:

    • Implement FRET-based sensors for phosphatidic acid

    • Use super-resolution microscopy to visualize membrane domains

    • Apply correlative light and electron microscopy for structural context

    • Develop live-cell imaging approaches to monitor dynamic changes

This integrated approach connects AGPAT1's enzymatic function to its broader roles in membrane homeostasis and cellular signaling, providing insights into how lipid metabolism influences membrane-dependent cellular processes.

What are the most promising methodologies for investigating potential non-canonical functions of AGPAT1?

Recent research suggests AGPAT1 may have functions beyond its canonical role in phospholipid synthesis. To investigate these non-canonical functions, consider these methodological approaches:

  • Protein-protein interaction mapping:

    • BioID or APEX proximity labeling:

      • Express AGPAT1 fused to BioID2 or APEX2

      • Identify proximal proteins by streptavidin pulldown and mass spectrometry

      • Compare interactomes across different cell types and conditions

    • Co-immunoprecipitation coupled with mass spectrometry:

      • Use epitope-tagged AGPAT1 (e.g., FLAG, V5)

      • Perform pulldowns under varying detergent conditions

      • Include crosslinking approaches for transient interactions

    • Yeast two-hybrid screening:

      • Use domain-specific baits to identify interaction partners

      • Validate hits with mammalian co-IP experiments

  • Enzyme-independent function analysis:

    • Generate catalytically inactive mutants (target conserved acyltransferase motifs)

    • Compare phenotypes between knockout and catalytic-dead mutants

    • Assess protein scaffolding functions

    • Evaluate potential moonlighting activities

  • Subcellular localization studies:

    • Perform dynamic localization studies under various stimuli

    • Identify potential stimulus-dependent translocation

    • Apply live-cell imaging with fluorescently tagged AGPAT1

    • Investigate potential nuclear functions or signaling roles

  • Post-translational modification analysis:

    • Identify phosphorylation, acetylation, or other modifications by mass spectrometry

    • Assess how modifications affect activity and interactions

    • Investigate regulatory pathways controlling AGPAT1 modifications

    • Generate modification-specific antibodies for functional studies

  • Signaling pathway analysis:

    • Perform phosphoproteomic analysis in AGPAT1-manipulated cells

    • Identify altered signaling networks

    • Use pathway inhibitors to dissect contributions

    • Validate with reporter assays and functional endpoints

This comprehensive approach enables the identification and characterization of non-canonical AGPAT1 functions that may contribute to its complex physiological roles and disease associations.

What statistical approaches are most appropriate for analyzing AGPAT1 expression data across disease states?

For robust analysis of AGPAT1 expression across disease states, implement the following statistical framework:

  • Data preprocessing and normalization:

    • For qPCR: Normalize to multiple reference genes using geometric averaging

    • For proteomics: Apply total protein approach with raw spectral intensities

    • For immunohistochemistry: Use automated image analysis with standardized intensity thresholds

    • Log-transform data if not normally distributed

  • Statistical testing framework:

    • Two-group comparisons:

      • Student's t-test for normally distributed data

      • Mann-Whitney U test for non-parametric data

      • Report mean differences with 95% confidence intervals

    • Multiple group comparisons:

      • ANOVA followed by post-hoc tests (e.g., Tukey test) for normally distributed data

      • Kruskal-Wallis with Dunn's post-hoc for non-parametric data

      • Example from AGPAT1 PSC-UC study: "Results showed significant differences (p < 0.01) in AGPAT1 levels between groups using Tukey test"

    • Adjustment for confounding factors:

      • Linear regression models adjusting for age, sex, medication use

      • ANCOVA for controlling continuous covariates

      • Example: "AGPAT1 remained significant (p = 8.2e-05) after adjusting for age and thiopurine use"

  • Multiple testing correction:

    • For genome/proteome-wide studies: Bonferroni or Benjamini-Hochberg FDR

    • Set appropriate significance thresholds (e.g., p < 0.01 for validation cohorts)

    • Report both raw and adjusted p-values

  • Meta-analysis techniques:

    • Fixed or random effects models depending on heterogeneity

    • Combine discovery and validation datasets

    • Example: "In meta-analysis of 6,121 proteins, AGPAT1 had the lowest p-value (3.6e-06)"

  • Data visualization:

    • Present data as boxplots showing median, quartiles, and range

    • For categorical IHC data, use donut charts to show proportions of staining categories

    • Include representative images with standardized magnification (e.g., ×40 and ×400)

This comprehensive statistical framework ensures robust analysis and interpretation of AGPAT1 expression data across disease states, accounting for biological variability and potential confounders.

How can researchers effectively integrate multi-omic data to understand the systemic impact of AGPAT1 modulation?

Integrating multi-omic data for comprehensive understanding of AGPAT1 function requires a systematic approach:

  • Data collection and preprocessing strategy:

    • Transcriptomics:

      • RNA-seq of tissues from wild-type and AGPAT1-modulated models

      • Standardize with spike-in controls

      • Process with consistent bioinformatic pipelines

    • Proteomics:

      • Use consistent sample preparation methods (e.g., filter-aided sample preparation)

      • Implement label-free quantification or TMT labeling

      • Include quality control standards

    • Lipidomics:

      • Comprehensive profiling of glycerophospholipids, sphingolipids, and neutral lipids

      • Include internal standards for each lipid class

      • Normalize to tissue weight or protein content

    • Metabolomics:

      • Target central carbon metabolism and lipid-related pathways

      • Combine targeted and untargeted approaches

      • Implement stable isotope tracing when applicable

  • Integration approaches:

    • Correlation network analysis:

      • Construct networks of correlated features across data types

      • Identify modules associated with AGPAT1 modulation

      • Apply WGCNA or similar methods for module detection

    • Pathway enrichment across data types:

      • Apply consistent pathway definitions across omics

      • Use tools supporting multi-omic integration (e.g., MetaboAnalyst, IPA)

      • Implement joint pathway enrichment tests

    • Causal modeling:

      • Build directed graphs representing potential causal relationships

      • Apply Bayesian network inference

      • Validate with targeted perturbation experiments

  • Data visualization strategies:

    • Implement multi-omic visualization tools (e.g., Cytoscape, OmicsAnalyst)

    • Create integrated heatmaps showing patterns across data types

    • Develop pathway visualizations with multi-omic overlay

  • Validation experiments:

    • Design targeted experiments to test predictions from integrated analysis

    • Implement CRISPR screens for validating key nodes

    • Use small molecule inhibitors to perturb predicted pathways

This integrated approach enables researchers to move beyond isolated datasets to understand how AGPAT1 modulation affects the entire cellular system, revealing emergent properties not apparent from single-omic studies.

What are the most promising areas for future AGPAT1 research based on current findings?

Based on recent discoveries and technological advances, the following research directions represent high-priority areas for future AGPAT1 investigations:

  • Structural biology and regulation:

    • Determine high-resolution structures of AGPAT1 using cryo-EM or X-ray crystallography

    • Characterize conformational changes during catalysis

    • Identify regulatory post-translational modifications

    • Elucidate mechanisms of substrate specificity compared to other AGPAT isoforms

  • Inflammatory disease mechanisms:

    • Further investigate AGPAT1's role in discriminating ulcerative colitis subtypes

    • Explore mechanisms linking phospholipid metabolism to intestinal inflammation

    • Identify downstream signaling pathways affected by altered AGPAT1 expression

    • Develop AGPAT1-based diagnostic tests for clinical application

  • Neurological functions:

    • Characterize detailed neurological phenotypes in conditional knockout models

    • Investigate mechanisms behind increased locomotor activity in Agpat1-/- mice

    • Examine roles in neurotransmission and synaptic plasticity

    • Explore potential connections to neurological disorders

  • Metabolic disease connections:

    • Investigate tissue-specific roles in insulin resistance pathways

    • Examine potential therapeutic applications in lipodystrophy

    • Study interactions with other lipid metabolism enzymes in metabolic regulation

    • Explore connections to mitochondrial function and metabolic flexibility

  • Cancer biology:

    • Follow up on AGPAT1's identified role as a negative prognostic marker in colorectal cancer

    • Investigate mechanisms linking phosphatidic acid production to cancer cell metabolism

    • Explore potential as a therapeutic target in specific cancer subtypes

    • Study effects on cancer cell membrane properties and signaling

These research directions build upon current findings while addressing significant gaps in our understanding of AGPAT1 biology, with potential implications for diagnostic and therapeutic applications.

What technological advances might significantly enhance AGPAT1 research in the next five years?

Several emerging technologies are poised to dramatically advance AGPAT1 research in the near future:

  • Advanced structural biology techniques:

    • AlphaFold and other AI-based structure prediction tools for modeling AGPAT1 variants

    • Cryo-EM advances for membrane protein structures without crystallization

    • Time-resolved structural studies to capture enzyme dynamics during catalysis

    • Integrative structural biology combining multiple experimental approaches

  • Spatially resolved omics:

    • Spatial transcriptomics to map AGPAT1 expression patterns with cellular resolution

    • Imaging mass spectrometry for spatial lipidomics of tissues

    • Spatial proteomics to correlate AGPAT1 with interaction partners in situ

    • Multi-modal spatial analysis integrating multiple data types

  • Single-cell technologies:

    • Single-cell metabolomics to capture cell-to-cell variability in lipid metabolism

    • Single-cell proteomics to identify rare cell populations with unique AGPAT1 expression

    • Integrated single-cell multi-omics to link transcription, translation and metabolism

    • Live-cell tracking of phospholipid metabolism

  • Genome editing advances:

    • Base editing for precise engineering of AGPAT1 variants without double-strand breaks

    • Prime editing for flexible gene modification with reduced off-target effects

    • Multiplex CRISPR screens to identify genetic modifiers of AGPAT1 function

    • In vivo editing technologies for tissue-specific manipulation

  • Advanced bioimaging:

    • Expansion microscopy for nanoscale visualization of AGPAT1 localization

    • Genetically encoded sensors for phosphatidic acid and other lipid species

    • Label-free imaging of lipid metabolism using stimulated Raman scattering

    • Correlative light and electron microscopy for combining functional and structural imaging

These technological advances will enable researchers to address previously intractable questions about AGPAT1 function, regulation, and its role in cellular physiology and disease pathogenesis.

What interdisciplinary approaches might yield novel insights into AGPAT1 biology?

Interdisciplinary collaborations offer unique opportunities to advance AGPAT1 research beyond traditional boundaries:

  • Systems biology and computational modeling:

    • Develop predictive models of lipid metabolism incorporating AGPAT1 kinetics

    • Apply machine learning to identify patterns in multi-omic data from AGPAT1 studies

    • Create virtual cell models to simulate effects of AGPAT1 modulation

    • Implement flux balance analysis to quantify metabolic rewiring

  • Bioengineering approaches:

    • Design synthetic lipid biosynthesis pathways with modified AGPAT1 variants

    • Create optogenetic tools for spatiotemporal control of AGPAT1 activity

    • Develop microfluidic systems for high-throughput AGPAT1 enzymatic assays

    • Engineer biomimetic membranes to study AGPAT1 in controlled environments

  • Clinical translational research:

    • Establish biobanks with samples from patients with AGPAT1-relevant pathologies

    • Perform association studies linking AGPAT1 variants to disease phenotypes

    • Develop clinical assays for AGPAT1 as a diagnostic or prognostic biomarker

    • Design early-phase clinical trials for AGPAT1 inhibitors in inflammatory conditions

  • Evolutionary biology perspectives:

    • Compare AGPAT isoforms across species to identify conserved functional domains

    • Study adaptations in lipid metabolism enzymes across different environmental niches

    • Investigate co-evolution of AGPAT1 with other components of lipid metabolic pathways

    • Reconstruct ancestral AGPAT sequences to understand evolutionary constraints

  • Nanotechnology integration:

    • Develop nanoscale delivery systems for AGPAT1 modulators

    • Create biosensors for real-time monitoring of AGPAT1 activity

    • Apply DNA-origami techniques to organize AGPAT1 in defined spatial arrangements

    • Implement nanopore sequencing for rapid detection of AGPAT1 variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.