Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4) is a purified enzyme produced via in vitro expression systems to study its role in lipid metabolism. AGPAT4, also termed lysophosphatidic acid acyltransferase delta (LPAATδ), catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a critical step in glycerophospholipid and triglyceride biosynthesis . Its recombinant form enables precise biochemical and therapeutic investigations.

Production Methodology

Recombinant AGPAT4 is synthesized through the following steps:

  1. Cloning: The AGPAT4 gene fragment (1–319aa) is inserted into a plasmid with regulatory elements for transcription .

  2. In Vitro Transcription: mRNA is generated from purified plasmid DNA .

  3. Translation: mRNA is translated using E. coli cell-free extracts supplemented with amino acids and energy sources .

  4. Purification: Affinity chromatography (e.g., His-tag or Strep-tag systems) isolates the protein .

Alternative systems, such as tobacco cell-free lysates (AliCE®), enhance yield for complex studies .

Functional Roles

AGPAT4 regulates lipid metabolism and membrane dynamics through:

  • PA Synthesis: Converts LPA to PA, a precursor for phospholipids and triglycerides .

  • Membrane Fission: Collaborates with the BARS/14-3-3γ/PI4KIIIβ complex to induce PA-dependent membrane remodeling at the trans-Golgi network .

  • Mitochondrial Dynamics: Modulates mitochondrial membrane fusion/fission via PA production .

Cancer Biology

  • Colorectal Cancer (CRC): AGPAT4 is overexpressed in CRC tissues and correlates with poor patient survival. Silencing AGPAT4 reduces tumor growth in vivo by releasing LPA, which polarizes macrophages to an M1 phenotype and activates CD4+/CD8+ T cells .

    • Mechanism: AGPAT4 depletion elevates LPA, activating p38/p65 signaling in macrophages and enhancing antitumor immunity .

AGPAT4 in CRCData
Expression in CRC vs. Normal↑3–5-fold (RNA-seq/IHC)
Survival CorrelationHigh AGPAT4 → Poor prognosis (HR = 2.1)
Therapeutic TargetAGPAT4 inhibition + chemotherapy synergizes tumor suppression

Adipose Tissue Metabolism

  • Epididymal Fat Enlargement: Agpat4−/− mice exhibit 40% larger epididymal white adipose tissue (WAT) due to reduced TAG hydrolase activity and ATGL/p-HSL dysregulation .

  • Depot-Specific Effects: Compensatory upregulation of other AGPAT isoforms occurs in perirenal WAT but not epididymal WAT, highlighting metabolic heterogeneity .

Neurological Functions

AGPAT4 supports phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) synthesis in the brain, critical for neural membrane integrity .

Applications in Research

  • Lipid Signaling Studies: Used to dissect PA’s role in membrane fission and organelle dynamics .

  • Cancer Therapeutics: Target for modulating tumor microenvironments via LPA-mediated immune activation .

  • Metabolic Disease Models: Investigating adipose tissue expansion and lipodystrophy .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Description

This recombinant human 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4) protein is produced in an in vitro E. coli expression system. The protein is tagged with an N-terminal 10xHis-tag. The full-length human AGPAT4 gene fragment (1-319aa) is cloned into a suitable expression vector, along with the N-terminal 10xHis-tag and necessary regulatory elements. The recombinant plasmid DNA containing the AGPAT4 gene fragment is then isolated and purified. In vitro transcription is performed using the purified plasmid DNA to synthesize mRNA, which acts as a template in the subsequent in vitro translation reaction. The translation reaction is carried out using an E. coli cell-free extract supplemented with energy sources and amino acids. After incubation, the recombinant AGPAT4 protein is purified from the cell culture medium. The purity of the recombinant AGPAT4 protein, reaching up to 85%, is assessed by SDS-PAGE analysis, where it appears as a band with a molecular weight of approximately 40 kDa.

Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-319aa
Mol. Weight
45.5 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND-
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
AGPAT4 converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by adding an acyl moiety at the sn-2 position of the glycerol backbone. It exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Database Links

HGNC: 20885

OMIM: 614795

KEGG: hsa:56895

STRING: 9606.ENSP00000314036

UniGene: Hs.353175

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus.

Q&A

What is the catalytic function of AGPAT4?

AGPAT4 functions as a true acylglycerophosphate acyltransferase/lysophosphatidic acid acyltransferase (AGPAT/LPAAT), catalyzing the acyl-CoA-dependent formation of phosphatidic acid (PA) using lysophosphatidic acid (LPA) as the preferred acyl acceptor. In vitro assays have confirmed that AGPAT4 specifically functions as an LPAAT, utilizing LPA as its primary lysophospholipid acyl-acceptor . This represents the second committed step in the Kennedy pathway for the de novo biosynthesis of glycerophospholipids and triacylglycerol (TAG) .

What are the conserved domains and motifs in AGPAT4?

Like other members of the AGPAT family, AGPAT4 contains two highly conserved catalytic motifs: NHX4D and a downstream proline residue. It also contains two substrate binding motifs: EGTR and FX2R . These conserved regions are critical for the enzyme's function. The catalytic motif known as "Motif I" (HXXXXD) is particularly important, as it is responsible for the acyltransferase activity of the enzyme .

How does AGPAT4 differ from other AGPAT family members?

While 11 AGPAT family members have been identified based on sequence homology, functional characterization has narrowed the group of true AGPATs/LPAATs that prefer LPA to only 5 isoforms: AGPATs 1, 2, 3, 4, and 5 . The remaining members primarily utilize different lysophospholipid acyl-acceptors or glycerol-3-phosphate. AGPAT4 displays a more tissue-specific expression pattern compared to ubiquitously expressed isoforms like AGPATs 1 and 3 .

What is the subcellular localization of AGPAT4?

AGPAT4 is predominantly localized to mitochondria. Studies have demonstrated that both endogenous brain AGPAT4 and AGPAT4 overexpressed in HEK293 or Sf9 insect cells localizes specifically to mitochondria . Further investigations have revealed that AGPAT4 is resident on the outer mitochondrial membrane , which has important implications for its function in lipid metabolism and cellular signaling.

What is the tissue distribution pattern of AGPAT4?

AGPAT4 shows a distinct tissue-specific expression profile. While it is expressed in multiple mouse brain regions , it also shows relatively consistent expression across various white adipose tissue depots . The differential expression patterns of AGPAT isoforms suggest that each may serve tissue-specific functions, despite catalyzing similar biochemical reactions .

How can researchers experimentally determine AGPAT4 expression levels in different tissues?

Researchers can use reverse transcriptase real-time quantitative polymerase chain reaction (RT-qPCR) with isoform-specific primers to quantify AGPAT4 mRNA expression across different tissues . For protein-level analysis, western blotting with specific antibodies against AGPAT4 can be employed. Immunohistochemistry can also be used to visualize the distribution of AGPAT4 within tissue sections. When examining splice variants, designing unique N-terminal primer sequences to distinguish the variants is essential .

What are effective approaches for overexpressing recombinant AGPAT4 in cell culture?

Recombinant AGPAT4 can be effectively overexpressed in various cell lines, including HEK293 and Sf9 insect cells . For optimal expression, researchers should:

  • Clone the full AGPAT4 coding sequence into an appropriate expression vector with a strong promoter

  • Include an affinity tag (such as His-tag or HA-tag) for purification and detection

  • Optimize transfection conditions for the specific cell line

  • Confirm expression by western blot analysis

  • Verify subcellular localization using fluorescent microscopy or subcellular fractionation approaches

How can AGPAT4 enzymatic activity be measured in vitro?

AGPAT4 enzymatic activity can be assessed using various biochemical assays:

  • Radiometric assay: This approach uses radiolabeled acyl-CoA and measures the incorporation of the radiolabel into phosphatidic acid.

  • Colorimetric assay: This method quantifies the release of CoA during the acyltransferase reaction, which can be detected using reagents that react with free thiol groups.

  • Mass spectrometry-based approaches: These methods enable direct measurement of AGPAT4 products and can provide detailed information about acyl chain specificity.

Regardless of the method, reactions typically contain:

  • LPA as the acyl acceptor

  • Acyl-CoA as the acyl donor

  • Appropriate buffer conditions (pH ~7.4)

  • Divalent cations (usually Mg²⁺)

  • Purified enzyme or membrane fractions containing AGPAT4

What methods can be used to investigate protein-protein interactions involving AGPAT4?

Several complementary approaches can be used to study AGPAT4 interactions:

  • Protein pull-down assays: Immobilized metal affinity chromatography (IMAC) can be used to determine if truncated AGPAT4 forms a protein complex with the reference AGPAT4 protein .

  • Co-immunoprecipitation: This technique can be employed using expression vectors for uniquely tagged AGPAT4 variants (e.g., hemagglutinin-tagged truncated AGPAT4) .

  • Proximity labeling approaches: BioID or APEX2-based approaches can identify proteins in close proximity to AGPAT4 in living cells.

  • Yeast two-hybrid screening: This method can identify potential interacting partners from a library of proteins.

What splice variants of AGPAT4 have been identified and what are their structural differences?

Three alternative predicted mRNA transcripts for murine Agpat4 have been identified beyond the reference sequence:

How can researchers detect and distinguish between AGPAT4 splice variants?

Researchers can detect and distinguish AGPAT4 splice variants using:

  • RT-PCR with variant-specific primers: Design primers that target unique regions of each variant. For example, primers within the protein coding region shared by predicted splice variants X2 and X3 can amplify these specific variants .

  • RT-qPCR for quantitative analysis: This approach allows for determination of the relative abundance of each variant across different tissues. Design unique N-terminal primer sequences to distinguish between variants .

  • Western blotting: Antibodies that recognize epitopes present in specific variants can be used to detect the different protein isoforms.

What is the functional significance of the truncated AGPAT4 isoform lacking Motif I?

The truncated AGPAT4 isoform (predicted from variants X2 and X3) lacks the first conserved motif (HXXXXD) responsible for catalytic activity. This suggests that this isoform may not possess typical AGPAT enzymatic activity. Possible functional roles could include:

  • Regulatory function through protein-protein interactions with the full-length AGPAT4 or other proteins

  • Dominant-negative effects by competing for binding partners or substrates

  • Alternative non-catalytic functions not yet characterized

Research techniques to elucidate these potential functions include protein pull-down assays, co-immunoprecipitation, and graded cell transfections using expression vectors for both reference AGPAT4 and truncated AGPAT4 with unique protein affinity tags .

What role does AGPAT4 play in phospholipid metabolism in the brain?

AGPAT4 plays a crucial role in brain phospholipid metabolism:

  • In vitro overexpression studies showed that AGPAT4 specifically increased cellular phosphatidylinositol (PI) content by 72% in Sf9 insect cells relative to control cells, while other phospholipids including PA did not change significantly .

  • In vivo studies with Agpat4 knockout mice demonstrated:

    • A significant 52% decrease in brain PI content

    • A 39% decrease in phosphatidylcholine (PC)

    • A 32% decrease in phosphatidylethanolamine (PE)

These findings suggest that AGPAT4-derived PA forms a functionally distinct substrate pool for the synthesis of specific downstream phospholipid species in the brain . This explains why multiple AGPAT/LPAAT isoforms may be expressed in the same tissue - they likely serve distinct metabolic functions.

How does AGPAT4 affect cognitive function?

Studies using Agpat4 knockout mice have revealed important insights into AGPAT4's role in cognitive function:

  • Agpat4 gene ablation correlated with significantly poorer outcomes in the Morris Water Maze test, indicating impaired spatial learning and memory in knockout mice compared to wild-type littermates .

  • This reduction in cognitive function has been hypothetically attributed to the decrease in brain PC, PE, and PI content, which was further linked to a decrease in NMDA and AMPA receptor subunits in the brain .

These findings highlight the importance of AGPAT4-mediated phospholipid metabolism for normal brain function and cognitive processes.

What impact does AGPAT4 have on muscle physiology?

AGPAT4 plays significant roles in skeletal muscle physiology:

  • Agpat4 knockout mice display alterations in muscle properties, including fiber type composition and force contractility.

  • Immunohistochemical analysis showed that Agpat4-ablated mice had a reduction in type I and type IIA muscle fibers in the glycolytic extensor digitorum longus (EDL) muscle .

  • Electrical stimulation tests revealed significant decreases in soleus (an oxidative muscle) contractile force in mice lacking AGPAT4 .

  • These changes have been hypothesized to relate to decreasing pyruvate dehydrogenase activity and alterations in skeletal muscle phosphatidic acid and phosphatidylethanolamine content in Agpat4 knockout models .

How does AGPAT4 deficiency affect adipose tissue in animal models?

AGPAT4 deficiency reveals heterogeneity between white adipose tissue depots:

  • In wild-type mice, Agpat4 has relatively consistent expression across various white adipose tissue depots .

  • Ablation of Agpat4 led to a 40% increase in epididymal fat depot weight in male knockout mice compared to wild-type mice .

  • This difference was not caused by alterations in metabolic processes, food intake, or varying activity levels .

  • Histological analysis revealed that hypertrophic changes in the adipocytes of epididymal fat from male Agpat4 knockouts were the likely source of the observed differences .

This depot-specific effect highlights the molecular heterogeneity of different adipose tissue depots and suggests that AGPAT4 plays distinct roles in different fat depots.

What experimental approaches should researchers consider when generating and validating AGPAT4 knockout models?

When generating and validating AGPAT4 knockout models, researchers should consider:

  • Targeting strategy: Ensure complete ablation of all functional domains, including consideration of potential splice variants.

  • Validation approaches:

    • Confirm gene deletion at the DNA level

    • Verify absence of mRNA expression using RT-qPCR

    • Confirm protein depletion using western blotting

    • Assess enzyme activity to confirm functional knockout

  • Phenotypic characterization:

    • Comprehensive tissue analysis (brain, adipose tissue, muscle)

    • Behavioral tests for cognitive function

    • Metabolic assessments

    • Phospholipid profiling using mass spectrometry

  • Control considerations: Use wild-type littermates as controls to minimize genetic background effects.

  • Age and sex considerations: Examine both sexes at different ages, as some phenotypes may be sex-specific (as seen with epididymal fat) or age-dependent.

How might AGPAT4 function be regulated at the post-translational level?

Advanced research into AGPAT4 post-translational regulation could explore:

  • Phosphorylation: Identify potential phosphorylation sites and kinases that might modulate AGPAT4 activity in response to cellular signaling.

  • Protein-protein interactions: Investigate if AGPAT4 forms complexes with other enzymes or regulatory proteins that might influence its activity or localization.

  • Membrane lipid environment: Examine how the composition of the outer mitochondrial membrane affects AGPAT4 activity and substrate specificity.

  • Metabolic regulation: Study how changes in cellular energy status, such as through AMP-activated protein kinase (AMPK) activation, might impact AGPAT4 function.

  • Redox regulation: Investigate whether AGPAT4 activity is sensitive to cellular redox state, particularly given its mitochondrial localization.

What molecular mechanisms explain the tissue-specific roles of AGPAT4 despite its catalytic similarity to other AGPAT isoforms?

The following molecular mechanisms might explain tissue-specific roles of AGPAT4:

  • Subcellular compartmentalization: AGPAT4's unique mitochondrial localization likely creates distinct pools of PA that feed into specific downstream pathways.

  • Substrate preferences: While categorized as an LPAAT, AGPAT4 may have subtle preferences for specific acyl-CoA species that promote synthesis of tissue-specific lipid profiles.

  • Interaction networks: AGPAT4 may interact with different protein partners in different tissues, directing its activity toward specific metabolic outcomes.

  • Tissue-specific expression of splice variants: Different tissues may express varying ratios of AGPAT4 splice variants, creating functional diversity.

  • Integration with tissue-specific metabolic pathways: AGPAT4 may be integrated into different metabolic pathways depending on the tissue's specific energetic and synthetic requirements.

What are the implications of AGPAT4 research for understanding human neurological disorders?

Given AGPAT4's roles in brain phospholipid metabolism and cognitive function, several implications for neurological disorders emerge:

  • Neurodegenerative diseases: Alterations in membrane phospholipid composition are observed in conditions like Alzheimer's and Parkinson's disease; AGPAT4 dysfunction might contribute to these changes.

  • Cognitive disorders: The link between AGPAT4 and learning/memory suggests potential roles in cognitive disorders, possibly through effects on neurotransmitter receptor levels.

  • Mitochondrial disorders: As a mitochondrial protein, AGPAT4 dysfunction might contribute to disorders characterized by mitochondrial abnormalities, which often present with neurological symptoms.

  • Therapeutic targeting: Understanding AGPAT4's role might reveal new therapeutic strategies for modulating brain phospholipid composition in neurological conditions.

  • Biomarker development: Changes in AGPAT4 expression or activity might serve as biomarkers for certain neurological conditions.

How can researchers approach the study of potential interactions between AGPAT4 and other lipid metabolism enzymes?

To study interactions between AGPAT4 and other lipid metabolism enzymes, researchers can:

  • Employ systems biology approaches: Use lipidomics, proteomics, and transcriptomics to map changes in lipid profiles and enzyme networks in response to AGPAT4 manipulation.

  • Develop reconstituted systems: Create in vitro systems with purified enzymes to study direct metabolic channeling and enzyme cooperation.

  • Utilize proximity labeling approaches: Apply BioID or APEX2 fusion proteins to identify proteins in close proximity to AGPAT4 in its native environment.

  • Apply genetic interaction screens: Use CRISPR-based approaches to identify synthetic lethal or synthetic viable interactions between AGPAT4 and other lipid metabolism genes.

  • Develop computational models: Create kinetic models of lipid metabolism that incorporate AGPAT4 and related enzymes to predict metabolic outcomes of various perturbations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.