Recombinant Human 2-acylglycerol O-acyltransferase 1 (MOGAT1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human 2-acylglycerol O-acyltransferase 1 (MOGAT1) is an enzyme that plays a crucial role in lipid metabolism . Specifically, MOGAT1 catalyzes the conversion of monoacylglycerols (MAG) to diacylglycerols (DAG) . DAG is a precursor to other physiologically important lipids, including phosphatidylcholine, phosphatidylethanolamine, and triacylglycerol (TAG) . MOGAT1 has an essential role in reducing obesity and hepatic steatosis .

Gene Expression and Function

MOGAT1 expression is tissue-restricted, with high expression levels observed in the kidney, stomach, and adipose tissue, but minimal expression in the normal adult liver . In the liver, MOGAT1 is involved in triglyceride synthesis and storage . Studies have indicated that MOGAT1 interacts with DGAT2, which increases the synergy of TAG biosynthesis and lipid droplets expansion, leading to an increase in lipid accumulation in the liver and fat .

Role in Metabolic Diseases

Inhibition of hepatic MOGAT1 in mice fed a high-fat diet improves hepatic metabolic abnormalities without reducing liver inflammation and injury .

Regulation of MOGAT1

In-silico analysis has revealed several peroxisome proliferator response element (PPRE) binding sites in the promoters of both human and mouse MOGAT1 . These sites respond to all three peroxisome proliferator-activated receptor (PPAR) isoforms, such that their respective agonist or antagonist activated or inhibited the expression of MOGAT1 .

MOGAT1 and Fatty Acid Oxidation

Knockdown of MOGAT1 has been shown to increase fatty acid oxidation and reduce lipogenesis . Rates of palmitate oxidation were significantly increased, whereas rates of fatty acid synthesis were significantly reduced, by MOGAT1 ASO treatment . MOGAT1 ASO treatment was also associated with an increase in TG turnover in isolated hepatocytes .

MOGAT1 in Adipocytes

Mogat1 may play a role in adipocyte differentiation in vitro but not adipose tissue expansion in response to nutrient overload in mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOGAT1; DC2; DGAT2L1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Diacylglycerol O-acyltransferase candidate 2; hDC2; Diacylglycerol acyltransferase 2-like protein 1; Monoacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MOGAT1
Target Protein Sequence
MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYF DWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFG NFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGN ISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPE GSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Uniprot No.

Target Background

Function
Recombinant Human 2-acylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. It is likely not involved in dietary fat absorption in the small intestine.
Database Links

HGNC: 18210

OMIM: 610268

KEGG: hsa:116255

STRING: 9606.ENSP00000406674

UniGene: Hs.344090

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in stomach and liver.

Q&A

What is the primary function of MOGAT1 in cellular lipid metabolism?

MOGAT1 catalyzes the conversion of monoacylglycerol to diacylglycerol, which is the penultimate step in one pathway for triacylglycerol synthesis . This enzymatic activity is distinct from but complementary to the glycerol-3-phosphate pathway for triglyceride synthesis. Current research suggests that while MOGAT1 demonstrates MGAT (monoacylglycerol acyltransferase) activity in in vitro assays, its physiological function may be more complex than initially thought . Studies using recombinant MOGAT1 expressed in Spodoptera frugiperda (Sf9) insect cells have confirmed this enzymatic activity under controlled conditions .

How is MOGAT1 expression regulated during adipocyte differentiation?

MOGAT1 expression is highly induced during the differentiation of both mouse and human precursor cells into mature adipocytes . The enzyme's expression pattern follows a specific temporal sequence during the adipogenic program, with significant upregulation occurring early in the differentiation process . This temporal expression pattern suggests a potential role in establishing or maintaining adipocyte identity or function.

Methodologically, researchers can monitor MOGAT1 expression during adipogenesis using:

  • Quantitative PCR to measure mRNA levels at different time points during differentiation

  • Western blotting to assess protein expression using specific antibodies against MOGAT1

  • In vitro differentiation models of 3T3-L1 cells or primary preadipocytes, coupled with gene expression analysis

Interestingly, adipose tissue MOGAT1 expression is reduced in genetic models of marked obesity (db/db mice) and in abdominal fat of people with obesity who exhibit metabolic abnormalities compared to those with metabolically-healthy obesity . This suggests that MOGAT1 expression may be a marker for adipocyte metabolic health rather than simply correlating with adiposity.

What are the recommended methods for measuring MOGAT1 enzymatic activity in research settings?

Several established protocols exist for measuring MOGAT1 enzymatic activity:

In vitro MGAT assays using tissue homogenates:

  • Prepare tissue homogenates from the organ of interest (liver, adipose tissue, etc.)

  • Start reactions by adding homogenates to an assay mixture containing radioactively labeled substrates

  • Stop reactions after a defined time period (e.g., 5 minutes) using chloroform:methanol (2:1, v:v)

  • Extract, dry, and separate lipids using thin-layer chromatography (TLC) on silica gel G-60 plates

  • Visualize lipid bands using iodine vapor and identify products by comparison with lipid standards

  • Quantify the incorporation of radioactive substrates into lipid products using an imaging scanner followed by scintillation counting

Recombinant protein-based assays:
For studies requiring isolated enzyme activity, recombinant MOGAT1 can be expressed in expression systems such as Spodoptera frugiperda (Sf9) insect cells using baculovirus vectors . This approach allows for the assessment of enzyme kinetics without interference from other cellular processes.

When interpreting MGAT activity data, researchers should consider that:

  • Total MGAT activity in a tissue may reflect contributions from multiple MGAT enzymes, not just MOGAT1

  • The correlation between MOGAT1 expression and MGAT activity varies across tissues, suggesting tissue-specific regulation or alternative functions

  • Controls should include enzymatic assays with known MGAT inhibitors or using tissues from MOGAT1 knockout models

How can researchers effectively generate and validate MOGAT1 knockout or knockdown models?

Several approaches have been used to generate MOGAT1-deficient experimental models:

Genetic Knockout Strategies:

  • Constitutive global knockout: Targeting the MOGAT1 gene by deleting critical exons (e.g., exons 2-3) . This approach has been used to study the role of MOGAT1 in lipodystrophic and obese mouse models.

  • Conditional tissue-specific knockout: Using Cre-loxP systems to delete MOGAT1 specifically in target tissues like adipose tissue or liver . This approach allows researchers to distinguish tissue-specific effects from systemic adaptations to global deletion.

Validation methods include:

  • PCR genotyping using primers specific to the wild-type and targeted alleles

  • Southern blotting of genomic DNA using labeled oligonucleotide probes

  • Amplification of MOGAT1 from cDNA to confirm exon deletion

  • Western blotting to verify protein absence

  • MGAT activity assays to confirm functional consequences of gene deletion

RNA interference approaches:
Antisense oligonucleotides (ASOs) have been successfully used to knock down MOGAT1 expression in vivo . This approach offers temporal control over gene suppression and can be used in adult animals. ASO treatment in mice fed high-trans-fat, fructose, and cholesterol diets has been shown to improve glucose tolerance and reduce hepatic triacylglycerol content .

Researchers should consider potential compensatory mechanisms when interpreting results from knockout models, as other enzymes with MGAT activity might functionally compensate for MOGAT1 deficiency.

Why do global versus tissue-specific MOGAT1 knockout models show different metabolic phenotypes?

The discrepancy between phenotypes observed in global versus tissue-specific MOGAT1 knockout models highlights the complex role of this enzyme in metabolism. Global MOGAT1 knockout has been reported to lead to unexpected increases in weight gain in mice fed a high-fat diet , contrary to what might be predicted based on the enzyme's role in triglyceride synthesis.

Several factors may explain these differences:

  • Tissue-specific functions: MOGAT1 is expressed in multiple tissues including adipose tissue, liver, kidney, and stomach . Each tissue may have distinct regulatory mechanisms and metabolic roles for MOGAT1.

  • Developmental compensation: Global knockout from early development may trigger compensatory pathways that are not activated when the gene is deleted in a specific tissue or at later time points.

  • Inter-tissue metabolic communication: MOGAT1 function in one tissue may influence metabolic signaling to other tissues. For example, studies suggest a possible role of stomach MOGAT1 in glucose homeostasis, as MOGAT1-/- ob/ob mice showed altered responses to mixed meal tests .

  • Background strain effects: Research has shown that the genetic background of mice can significantly influence metabolic phenotypes. Studies reporting contradictory results often use mice of different or mixed genetic backgrounds .

To address these complexities, researchers should:

  • Include appropriate controls matched for genetic background

  • Measure MGAT activity in multiple tissues

  • Assess potential compensatory changes in related metabolic enzymes

  • Consider the timing of gene deletion using inducible systems

  • Evaluate tissue-specific versus systemic metabolic parameters

What explains the apparent disconnect between improved metabolic parameters and liver inflammation in MOGAT1 inhibition studies?

One of the most intriguing findings in MOGAT1 research is the observation that inhibition of MOGAT1 can improve glucose tolerance and reduce hepatic steatosis while either not affecting or possibly exacerbating markers of liver inflammation . This paradoxical effect was observed in studies using antisense oligonucleotides to knock down MOGAT1 in mice fed diets high in trans-fatty acids, fructose, and cholesterol.

Several hypotheses may explain this disconnect:

  • Differential lipid species effects: MOGAT1 inhibition selectively reduces triacylglycerol (TAG) content without affecting other potentially lipotoxic lipid species such as diacylglycerols, free fatty acids, and cholesterol . These other lipids may continue to drive inflammatory processes.

  • TAG as a protective lipid sink: Rather than being pathogenic, TAG may serve as a protective sink for potentially toxic fatty acids. By inhibiting MOGAT1 and reducing TAG synthesis, free fatty acids might be redirected to more inflammatory pathways .

  • Temporal considerations: Metabolic improvements may occur rapidly after MOGAT1 inhibition, while resolution of established inflammation may require longer treatment periods or additional interventions.

  • Pathway-specific effects: MOGAT1 inhibition increases rates of fatty acid oxidation and reduces de novo lipogenesis, which improves metabolic parameters, but may simultaneously activate inflammatory pathways through oxidative stress or other mechanisms .

Microarray analyses of livers from diet-induced obese mice treated with MOGAT1 ASOs revealed upregulation of pathways associated with oxidative stress and inflammation, despite improvements in metabolic parameters . This suggests that MOGAT1 inhibition may have dual, opposing effects on metabolism and inflammation.

Researchers investigating this phenomenon should consider:

  • Comprehensive lipidomic profiling beyond simple TAG measurements

  • Temporal studies with multiple endpoints to assess both acute and chronic effects

  • Combined interventions targeting both MOGAT1 and inflammatory pathways

  • Assessment of oxidative stress markers alongside metabolic parameters

How does MOGAT1 activity in adipocytes specifically contribute to whole-body metabolic homeostasis?

MOGAT1 expression in adipose tissue correlates positively with metabolic health markers in both humans and mice. In people with obesity, adipose tissue MOGAT1 expression positively correlates with glucose disposal rates during hyperinsulinemic-euglycemic clamps . Additionally, MOGAT1 expression in abdominal adipose tissue inversely correlates with basal rates of free fatty acid release, suggesting a role in regulating lipolysis .

Several mechanisms may link adipocyte MOGAT1 activity to whole-body metabolism:

  • Regulation of lipolysis: MOGAT1 may function to re-esterify fatty acids released during basal lipolysis, thereby preventing excessive free fatty acid release into circulation . This would reduce lipotoxicity in other tissues.

  • Adipocyte differentiation: MOGAT1 may play a role in adipocyte differentiation in vitro, potentially influencing adipose tissue expandability and function . Properly functioning adipose tissue is essential for metabolic health.

  • Adipokine secretion: Changes in adipocyte lipid metabolism due to altered MOGAT1 activity could affect the secretion of adipokines that influence whole-body insulin sensitivity.

  • Nutrient partitioning: By affecting adipose tissue lipid storage capacity, MOGAT1 may influence the distribution of dietary lipids between adipose tissue and ectopic sites.

Research approaches to address these questions include:

  • Adipocyte-specific MOGAT1 knockout models assessed under different dietary challenges

  • Ex vivo adipose tissue lipolysis assays comparing wild-type and MOGAT1-deficient adipocytes

  • Adipocyte-hepatocyte co-culture systems to assess inter-tissue metabolic communication

  • Metabolic phenotyping of adipocyte-specific MOGAT1 knockout mice using hyperinsulinemic-euglycemic clamps, metabolic cages, and tissue-specific glucose uptake measurements

How can researchers reconcile contradictory findings regarding MOGAT1's role in hepatic steatosis across different studies?

The literature contains seemingly contradictory findings regarding MOGAT1's role in hepatic steatosis. Some studies using antisense oligonucleotide approaches report that inhibiting MOGAT1 reduces liver triacylglycerol content and improves metabolic parameters , while genetic knockout studies report no decrease in hepatic steatosis .

To reconcile these contradictions, researchers should consider:

Experimental approach differences:

  • Acute vs. chronic intervention: Antisense oligonucleotide studies represent relatively acute interventions, while genetic knockout models reflect chronic, developmental adaptations to MOGAT1 deficiency .

  • Compensatory mechanisms: Long-term absence of MOGAT1 in knockout models may trigger compensatory upregulation of alternative pathways for triglyceride synthesis.

  • Technical methodology: The specific methods used to measure hepatic lipids (histology, biochemical extraction, imaging) may influence outcomes and interpretations.

Model-specific factors:

  • Genetic background: Studies reporting contradictory results often use mice of different or mixed genetic backgrounds, which can significantly influence metabolic phenotypes .

  • Diet composition: The specific dietary challenge used (high fat vs. trans fat/fructose/cholesterol) may interact differently with MOGAT1 deficiency .

  • Disease model: MOGAT1 deletion has been studied in multiple contexts, including lipodystrophic (Agpat2-/-) mice, obese (ob/ob) mice, and diet-induced obesity models .

Analytical considerations:

  • Comprehensive lipid profiling: Some studies focus exclusively on total TAG content, while others examine multiple lipid species. A recent study showed that while MOGAT1 inhibition reduced TAG, it did not affect DAG, free fatty acids, or cholesterol levels .

  • Tissue heterogeneity: Whole liver analyses may mask cell type-specific effects. MOGAT1 inhibition could affect hepatocytes differently than Kupffer cells or stellate cells.

  • Alternative enzyme functions: MOGAT1 may have functions beyond its characterized MGAT activity that influence hepatic metabolism independently of direct TAG synthesis .

A systematic research approach to address these contradictions would include:

  • Direct head-to-head comparisons of genetic knockout and ASO approaches in the same genetic background and disease model

  • Comprehensive lipidomic profiling rather than measurement of total TAG alone

  • Assessment of compensatory changes in related metabolic pathways

  • Cell type-specific analyses of hepatic lipid metabolism

  • Time-course studies to distinguish acute from chronic adaptations

What are the critical considerations for designing experiments to evaluate MOGAT1 as a therapeutic target for metabolic diseases?

When evaluating MOGAT1 as a potential therapeutic target for metabolic diseases, researchers should consider the following critical factors:

Target validation strategies:

  • Tissue specificity: Determine whether global or tissue-specific MOGAT1 inhibition is more beneficial. Evidence suggests that the effects of MOGAT1 inhibition differ between tissues, with complex outcomes in liver versus adipose tissue .

  • Disease context relevance: Evaluate MOGAT1 inhibition in models that closely recapitulate human disease. Studies show varying effects of MOGAT1 deletion in different models (lipodystrophic, obese, diet-induced) .

  • Temporal considerations: Assess both acute and chronic effects of MOGAT1 inhibition, as compensatory mechanisms may develop over time.

Efficacy assessments:

  • Comprehensive metabolic phenotyping:

    • Glucose tolerance tests (oral and intravenous)

    • Insulin sensitivity assessments (hyperinsulinemic-euglycemic clamps)

    • Mixed meal tolerance tests to evaluate real-world metabolic responses

    • Energy expenditure and substrate utilization measurements

    • Tissue-specific glucose uptake

  • Lipid metabolism assessments:

    • Comprehensive lipidomic profiling beyond TAG measurement

    • Flux analysis using stable isotopes to measure lipid synthesis and oxidation rates

    • Measurement of MGAT activity in multiple tissues

    • Assessment of fatty acid oxidation and de novo lipogenesis rates

Safety considerations:

  • Inflammatory markers: Evidence suggests MOGAT1 inhibition may have paradoxical effects on inflammation despite metabolic improvements . Comprehensive assessment of inflammatory markers in multiple tissues is essential.

  • Liver injury parameters: Studies should include histological assessment of liver injury, fibrosis markers, and liver function tests.

  • Effect on multiple tissues: Given MOGAT1's expression in multiple tissues, assess effects beyond the primary target tissue, especially in kidney and stomach where MOGAT1 is highly expressed .

Translational relevance:

  • Human correlation: Evaluate whether findings in animal models align with human MOGAT1 expression patterns and correlations with disease parameters .

  • Inhibition strategy: Consider the pros and cons of different inhibition approaches (small molecules, antisense oligonucleotides, etc.) regarding tissue specificity, durability of effect, and potential off-target actions.

  • Therapeutic window: Determine if partial MOGAT1 inhibition might deliver benefits while avoiding potential adverse effects associated with complete deletion.

Research suggests that while MOGAT1 inhibition improves certain metabolic parameters, particularly glucose metabolism and hepatic steatosis, it may not positively impact or may even worsen inflammatory aspects of metabolic disease . This complex relationship must be carefully considered when evaluating MOGAT1 as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.