Recombinant Human 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (UGT8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UGT8; CGT; UGT4; 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-541
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
UGT8
Target Protein Sequence
AKIIIVPPIMFESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNST TSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPN DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVY LISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVY VGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVI WRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETIYHGVPVVGIPLF GDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHP VNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALLYFLLSWVTKFIY RKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of galactose to ceramide, a crucial step in galactocerebroside biosynthesis. Galactocerebrosides are abundant sphingolipids in the myelin membranes of the central and peripheral nervous systems. The enzyme galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides.
Gene References Into Functions
  1. Down-regulation of UDP glycosyltransferase 8 (UGT8) resulted in increased ceramide immunolabelling compared to up-regulated or non-regulated UGT8 cells. PMID: 28746357
  2. While UGT8 expression is elevated in non-small cell lung carcinoma (NSCLC) tissues, it does not qualify as a lung tumor marker. PMID: 27620310
  3. CGT expression is regulated by a balance between the negative modulator OLIG2 and the positive regulator Nkx2.2, highlighting the precise control of GalCer expression in cell type- and stage-specific manners. PMID: 24821492
  4. UGT8 has been identified as a modulator of bile acid homeostasis. PMID: 25519837
  5. High UGT8 expression and GalCer accumulation in MDA-MB-231 cells correlate with higher proliferation and lower apoptosis compared to MDA/LUC-shUGT8 cells. PMID: 24391908
  6. UGT8 variants have been associated with musical ability in a Mongolian population. PMID: 23118445
  7. UGT8 is a significant indicator of tumor aggressiveness and is observed in lung metastases of breast cancer. PMID: 20648017
  8. Single-nucleotide polymorphisms (SNPs) have been identified in the UGT8 gene. PMID: 12376738
  9. The GC-box and CRE function cooperatively, with CRE regulating the cell-specific expression of the hCGT gene. PMID: 15229398
  10. A potential link exists between defective GALT enzyme (classic galactosemia) and cerebroside galactosyltransferase (galactosylation of cerebrosides), dependent on UDP-galactose concentrations. PMID: 16125333
  11. Galactosyl ceramide synthase gene expression is associated with poor pathohistological grading in breast cancer. PMID: 19125296
Database Links

HGNC: 12555

OMIM: 601291

KEGG: hsa:7368

STRING: 9606.ENSP00000311648

UniGene: Hs.144197

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein. Endoplasmic reticulum.

Q&A

What is UGT8 and what is its primary function in cellular metabolism?

UGT8 (UDP Glycosyltransferase 8), also known as CGT or UDP-Galactose Ceramide Galactosyltransferase, is an endoplasmic reticulum-localized enzyme that catalyzes the transfer of galactose to ceramide . This enzymatic reaction is a crucial step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids found in the myelin membrane of both the central and peripheral nervous systems .

The primary function of UGT8 is to synthesize galactosylceramide (GalCer), which serves as a major precursor for sulfatide production through the subsequent action of cerebroside sulfotransferase . Methodologically, researchers can assess UGT8 function through activity assays that measure the conversion of ceramide to galactosylceramide, often using radiolabeled UDP-galactose as a substrate.

How is UGT8 expressed in different tissue types and cancer subtypes?

UGT8 expression varies significantly across different tissue types, with particularly high expression in neural tissues involved in myelination. In pathological contexts, UGT8 shows distinct expression patterns across different breast cancer subtypes:

Breast Cancer SubtypeUGT8 Expression LevelAssociated Clinical Features
Basal-like/TNBCSignificantly elevatedPoor prognosis, increased metastatic potential
LuminalDramatically lowBetter prognosis, lower metastatic potential

Expression analysis through multiple methodologies (immunohistochemistry, RT-PCR, Western blotting) has consistently shown that UGT8 is significantly up-regulated in basal-like breast cancer (BLBC) and triple-negative breast cancer (TNBC) compared to luminal subtypes . Similar expression patterns are observed in corresponding cell lines, with BLBC cell lines showing much higher UGT8 mRNA and protein expression than luminal cell lines .

What experimental approaches are recommended for detecting and quantifying UGT8 in research samples?

Multiple experimental approaches are useful for detecting and quantifying UGT8:

  • Protein-level detection:

    • Western blotting using UGT8 polyclonal antibodies (e.g., Proteintech 17982-1-AP)

    • Immunohistochemistry (IHC) using the immunoreactivity scoring (IRS) scale for quantification

    • Flow cytometry for cellular expression analysis

  • mRNA-level detection:

    • Quantitative RT-PCR for relative expression quantification

    • Semiquantitative RT-PCR for expression screening

  • Activity measurement:

    • Enzymatic assays measuring galactosylation of ceramide

    • Detection of downstream metabolites (GalCer and sulfatide) as indicators of UGT8 activity

When analyzing UGT8 expression in clinical specimens, researchers should consider normalizing data to appropriate reference genes and including proper controls for experimental validation.

How does UGT8 contribute to cancer progression and metastasis?

UGT8 has emerged as a significant contributor to cancer progression, particularly in basal-like breast cancer. Multiple mechanisms have been elucidated:

  • Activation of the sulfatide–αVβ5 axis: UGT8 enhances production of sulfatide, which subsequently activates integrin αVβ5 clustering and signaling . This pathway activation leads to:

    • Enhanced cancer cell migration and invasion

    • Promotion of tumor growth

    • Increased metastatic potential, particularly to the lungs

  • Impact on ECM-receptor interaction: Transcriptomic analysis comparing UGT8 knockdown and zoledronic acid treatment revealed that ECM-receptor interaction is the most significantly affected pathway, indicating UGT8's role in modulating tumor-stroma interactions .

  • Cellular homeostasis disruption: Recent research indicates that UGT8-mediated synthesis of sulfatides controls mitochondrial homeostasis and BAX localization, which affects apoptosis sensitivity in cancer cells .

For researchers investigating UGT8's role in cancer, comprehensive approaches should include both in vitro functional assays (invasion, migration, colony formation) and in vivo metastasis models to fully characterize its impact on tumor progression.

What are the molecular mechanisms of UGT8 regulation in cancer cells?

UGT8 expression is tightly regulated at the transcriptional level, particularly in cancer contexts:

  • Transcriptional regulation by Sox10: Sox10 directly activates UGT8 expression by binding to multiple consensus motifs in the UGT8 promoter region . Luciferase reporter assays have identified specific regions between -2,211 and -1,507 bp and between -1,050 bp and -274 bp as critical for Sox10-mediated UGT8 activation .

  • Promoter binding mechanisms: The UGT8 promoter contains 10 putative consensus Sox10-binding motifs (A/T)(A/T)CAA(A/T)G from -2,211 bp to the transcription start site . Mutational analysis has shown that disruption of these binding sites significantly reduces Sox10-induced UGT8 expression .

Methodologically, researchers investigating UGT8 regulation should consider:

  • Chromatin immunoprecipitation (ChIP) assays to confirm transcription factor binding

  • Promoter-reporter constructs to identify critical regulatory regions

  • Site-directed mutagenesis to validate specific binding motifs

How can UGT8 be targeted therapeutically, and what experimental approaches validate these strategies?

UGT8 represents a promising therapeutic target, particularly for aggressive breast cancer subtypes. Several approaches have been developed:

  • Small molecule inhibitors:

    • Zoledronic acid (ZA) has been identified as a direct inhibitor of UGT8

    • Novel specific inhibitors like UGT8i19 have been developed and validated through cellular thermal shift assays

  • Genetic knockdown approaches:

    • shRNA-mediated knockdown of UGT8 has been shown to significantly suppress BLBC progression and metastasis

To validate UGT8 inhibition experimentally, researchers should employ:

  • Target engagement assays:

    • Cellular thermal shift assays to confirm direct binding of inhibitors to UGT8

    • Activity assays to measure functional inhibition

  • Downstream effect validation:

    • Measurement of GalCer and sulfatide levels via immunoblotting or immunostaining-confocal analysis

    • Assessment of integrin αVβ5 clustering and signaling

  • Functional consequences:

    • In vitro cell migration, invasion, and colony formation assays

    • In vivo tumor growth and metastasis models

What are the established protocols for analyzing UGT8-mediated metabolite production?

To effectively analyze UGT8-mediated metabolite production, researchers can employ these validated methodologies:

  • Immunoblotting of GalCer and sulfatide:

    • Prepare total lipid extracts from cells or tissues

    • Separate lipids via thin-layer chromatography

    • Transfer to PVDF membranes for immunodetection with anti-GalCer or anti-sulfatide antibodies

  • Immunofluorescence detection of metabolites:

    • Fix cells with 4% paraformaldehyde

    • Permeabilize and block with appropriate buffers

    • Stain with anti-GalCer or anti-sulfatide antibodies

    • Analyze via confocal microscopy

  • Enzymatic activity assays:

    • Measure UGT8 activity by quantifying the transfer of radiolabeled galactose from UDP-galactose to ceramide

    • Analyze reaction products by thin-layer chromatography followed by autoradiography

These methods should be accompanied by appropriate controls, including UGT8 knockdown or overexpression systems to validate specificity.

How should researchers design experiments to investigate UGT8's role in the sulfatide biosynthetic pathway?

When investigating UGT8's role in the sulfatide biosynthetic pathway, researchers should consider a systematic experimental approach:

  • Genetic manipulation strategies:

    • Generate stable cell lines with UGT8 knockdown (shRNA or CRISPR-Cas9) and overexpression models in relevant cell types

    • Create inducible expression systems to study temporal effects

    • Validate expression changes at both mRNA (RT-PCR) and protein (Western blot) levels

  • Metabolite profiling:

    • Analyze changes in both immediate (GalCer) and downstream (sulfatide) metabolites

    • Employ both qualitative (immunofluorescence) and quantitative (MS-based lipidomics) approaches

  • Functional pathway analysis:

    • Investigate the effect of pathway modulation through supplementation with exogenous metabolites

    • Examine expression and activity of other enzymes in the pathway (e.g., cerebroside sulfotransferase)

    • Conduct rescue experiments to confirm specificity of observed phenotypes

  • Integrative analysis:

    • Perform transcriptomic and proteomic analyses to identify global changes resulting from UGT8 modulation

    • Use KEGG pathway analysis to identify affected biological processes

What are the optimal conditions for working with recombinant UGT8 protein in enzymatic assays?

Based on available information about recombinant UGT8 protein properties, researchers should consider these parameters for enzymatic assays:

ParameterOptimal ConditionNotes
Storage4°C (short-term) or -20°C (long-term)Add carrier protein (0.1% HSA or BSA) for long-term storage; avoid freeze-thaw cycles
Buffer20mM Tris-HCl buffer (pH 8.0) with 0.4M urea and 10% glycerolStandard buffer for UGT8 activity
Substrate concentrationOptimize for specific experimental setupTypically use ceramide and UDP-galactose
Temperature37°CPhysiological temperature for enzymatic reactions
Reaction time15-60 minutesDetermine linear range for specific conditions
Detection methodTLC, HPLC, or mass spectrometryBased on required sensitivity and available equipment

When working with the recombinant human UGT8 protein (61.6 kDa), researchers should validate enzymatic activity using known substrates before proceeding with experimental assays .

How can UGT8 expression be utilized as a prognostic biomarker in cancer research?

UGT8 has significant potential as a prognostic biomarker, particularly in breast cancer research:

  • Validation approaches for UGT8 as a biomarker:

    • Immunohistochemical analysis of primary tumors using standardized scoring systems (e.g., IRS scale)

    • Correlation of expression levels with clinicopathological parameters (tumor grade, lymph node status, metastatic potential)

    • Multi-cohort validation of predictive ability at the mRNA level

  • Clinical correlation parameters:

    • UGT8 expression significantly differs between primary tumors and metastatic lesions (Mann–Whitney U, P<0.05)

    • Expression correlates with tumor malignancy grade (G3 vs G2: P<0.01; G3 vs G1: P<0.001)

    • Higher expression is associated with lymph node positivity (P<0.001)

    • Elevated expression correlates with increased risk of lung metastases

  • Implementation considerations:

    • Use standardized protocols for tissue processing and staining

    • Employ digital pathology approaches for objective quantification

    • Integrate UGT8 with other established biomarkers for improved prognostic value

For optimal results, researchers should design studies with sufficient statistical power and appropriate controls, including normal tissue and various cancer subtypes.

What are the current limitations in UGT8 research methodologies?

Several methodological challenges currently impact UGT8 research:

  • Enzymatic activity measurement:

    • Difficulty in establishing standardized, high-throughput assays for UGT8 activity

    • Challenges in differentiating UGT8 activity from other galactosyltransferases in complex systems

  • Inhibitor development:

    • Limited availability of specific, potent UGT8 inhibitors with optimal pharmacokinetic properties

    • Challenges in achieving selective inhibition without affecting related glycosyltransferases

  • Biological complexity:

    • Difficulty in dissecting UGT8's role in normal physiology versus pathological conditions

    • Challenges in studying tissue-specific effects due to varying expression patterns

  • Technical limitations:

    • Need for improved antibodies with higher specificity for various applications

    • Challenges in accurate quantification of lipid metabolites in complex biological samples

What emerging technologies might advance UGT8 research in the near future?

Several emerging technologies and approaches have potential to significantly advance UGT8 research:

  • CRISPR-Cas9 gene editing:

    • Generation of precise genetic models with conditional UGT8 knockout or mutation

    • Creation of reporter systems for real-time monitoring of UGT8 expression

  • Advanced lipidomics:

    • Implementation of high-resolution mass spectrometry for comprehensive profiling of UGT8-related metabolites

    • Spatial lipidomics for localization of GalCer and sulfatide in tissues and subcellular compartments

  • Structural biology approaches:

    • Cryo-EM structure determination of UGT8 to guide rational inhibitor design

    • Molecular dynamics simulations to understand enzyme function and regulation

  • Single-cell technologies:

    • Single-cell transcriptomics to reveal heterogeneity in UGT8 expression across tumor cells

    • Spatial transcriptomics to map UGT8 expression patterns within complex tissues

How does UGT8 interact with broader cellular signaling networks in health and disease?

UGT8's role extends beyond its enzymatic function, interacting with multiple cellular networks:

  • Integrin signaling pathways:

    • UGT8-produced sulfatide activates integrin αVβ5 clustering and signaling

    • This activation influences downstream pathways related to cell adhesion, migration, and survival

  • Mitochondrial function and apoptosis regulation:

    • UGT8-mediated sulfatide synthesis modulates BAX localization and mitochondrial homeostasis

    • This connection represents a novel link between lipid metabolism and cell death regulation

  • Cytoskeletal organization:

    • UGT8 is involved in cytoskeleton organization processes

    • This suggests potential influence on cell morphology, division, and motility

  • Nervous system development:

    • UGT8 participates in myelination, neuron projection morphogenesis, and paranodal junction assembly

    • These processes are essential for proper neural development and function

Researchers investigating these interactions should employ systems biology approaches, including network analysis of transcriptomic and proteomic data, to fully elucidate UGT8's position within cellular signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.