Recombinant Human 3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HSD3B7; 3 beta-hydroxysteroid dehydrogenase type 7; 3 beta-hydroxysteroid dehydrogenase type VII; 3-beta-HSD VII; 3-beta-hydroxy-Delta(5-C27 steroid oxidoreductase; C(27 3-beta-HSD; Cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HSD3B7
Target Protein Sequence
MADSAQAQKLVYLVTGGCGFLGEHVVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRV TAIQGDVTQAHEVAAAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQGTRNVIEACVQTG TRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRG GLPLVTCALRPTGIYGEGHQIMRDFYRQGLRLGGWLFRAIPASVEHGRVYVGNVAWMHVL AARELEQRATLMGGQVYFCYDGSPYRSYEDFNMEFLGPCGLRLVGARPLLPYWLLVFLAA LNALLQWLLRPLVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILW VQAATGSAQ
Uniprot No.

Target Background

Function

The 3β-hydroxysteroid dehydrogenase (3β-HSD) enzyme system is crucial for the biosynthesis of all steroid hormone classes. HSD7 exhibits activity against four 7α-hydroxylated sterols, but does not metabolize several C19/C21 steroids. It is involved in bile acid synthesis and plays a key role in lymphoid tissue cell positioning and movement by mediating the degradation of 7α,25-dihydroxycholesterol (7α,25-OHC). 7α,25-OHC acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for various lymphoid cells.

Gene References Into Functions
  1. Novel Mutations in the 3β-hydroxy-5-C27-steroid Dehydrogenase Gene (HSD3B7) in a Patient with Neonatal Cholestasis. PMID: 26712441
  2. Expression of steroid sulfated transporters and 3β-HSD activity in endometrium of polycystic ovary syndrome PMID: 26450365
  3. Homozygosity mapping identifies a bile acid biosynthetic defect (3β-HSD deficiency due to a frameshift mutation in HSD3B7) in an adult with cirrhosis of unknown etiology. PMID: 22095780
  4. Mutations in the HSD3B7 gene account for autosomal recessive neonatal cholestasis caused by 3β-hydroxy-Δ5-C27-steroid dehydrogenase/isomerase deficiency. PMID: 20531254
Database Links

HGNC: 18324

OMIM: 607764

KEGG: hsa:80270

STRING: 9606.ENSP00000297679

UniGene: Hs.460618

Involvement In Disease
Congenital bile acid synthesis defect 1 (CBAS1)
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the normal function of Human 3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7)?

HSD3B7 encodes an enzyme (3β-HSD7) that plays a crucial role in bile acid biosynthesis. The enzyme is specifically responsible for the second step in the multi-step process that converts cholesterol to bile acids. Its primary function is converting 7alpha(α)-hydroxycholesterol to 7α-hydroxy-4-cholesten-3-one . More significantly, HSD3B7 catalyzes two reactions required for the inversion of the 3β-hydroxyl group of cholesterol to the 3α-hydroxyl configuration of bile acids . This stereochemical modification is essential for maintaining the functional and regulatory properties of bile acids in the enterohepatic circulation. The enzyme's activity directly impacts bile acid production, which is necessary for fat digestion and absorption of fat-soluble vitamins .

Where is HSD3B7 expressed in the human body?

HSD3B7 is predominantly expressed in liver cells (hepatocytes), consistent with its central role in bile acid synthesis . This liver-specific expression pattern aligns with the pathophysiology observed in patients with congenital bile acid synthesis defect type 1, which primarily manifests as liver dysfunction. While the enzyme is most abundantly found in liver tissue, studies in mouse models have shown that its expression may vary during development and in specific embryonic tissues involved in the pathogenesis of congenital cholesterol-deficiency disorders . Expression studies in disease states such as breast cancer have also been conducted, though the primary physiological role remains centered on hepatic bile acid metabolism .

What is the subcellular localization of HSD3B7?

The 3β-HSD7 enzyme is embedded in the membrane of the endoplasmic reticulum (ER) . This subcellular localization is consistent with its function in cholesterol metabolism, as the ER is a major site for sterol biosynthesis and processing. Experimental verification of this localization has been achieved through fusion proteins with fluorescent tags. For instance, a fusion of HSD3B7 with green fluorescent protein localizes to the endoplasmic reticulum, confirming that the postsqualene cholesterogenesis occurs at this cellular site . This membrane integration is functionally significant as it positions the enzyme optimally for accessing its sterol substrates within the lipid bilayer and coordinating with other enzymes in the bile acid synthesis pathway.

What biochemical reactions does HSD3B7 catalyze?

HSD3B7 catalyzes a critical oxidoreduction reaction in bile acid synthesis pathway:

  • Primary reaction: Conversion of 7α-hydroxycholesterol to 7α-hydroxy-4-cholesten-3-one

  • Mechanistic function: Catalyzes the inversion of the 3β-hydroxyl group of cholesterol to the 3α-hydroxyl configuration required for functional bile acids

The enzyme functions as a 3β-hydroxy-delta 5-C27-steroid oxidoreductase, requiring appropriate cofactors for the reaction. Unlike other hydroxysteroid dehydrogenases (such as 7α-HSDH which uses NADP+ as cofactor ), specific cofactor requirements for HSD3B7 must be considered when designing activity assays. The stereochemistry of this reaction is particularly significant, as demonstrated in knockout mice where elimination of HSD3B7 prevents epimerization of the hydroxyl group at carbon 3 of the sterol nucleus, resulting in the synthesis of 3β-hydroxylated bile acids instead of the normal 3α-hydroxylated variants .

What health conditions are associated with HSD3B7 dysfunction?

The primary clinical condition associated with HSD3B7 mutations is congenital bile acid synthesis defect type 1, an autosomal recessive disorder characterized by:

  • Cholestasis (impaired bile flow)

  • Fat-soluble vitamin malabsorption

  • Progressive liver disease

  • Abnormal accumulation of intermediate bile acid metabolites

At least 17 different mutations in the HSD3B7 gene have been identified that cause this condition . Most mutations involve deletion of base pairs or replacement of single amino acids, resulting in a nonfunctional enzyme. Without functional HSD3B7, the conversion of 7α-hydroxycholesterol to 7α-hydroxy-4-cholesten-3-one is impaired, leading to accumulation of abnormal bile acid compounds that cannot be transported from the liver to the intestine . This impaired bile acid production causes cholestasis and malabsorption of fat-soluble vitamins.

In research contexts, knockout mouse models of HSD3B7 have been developed to study this condition. These models demonstrate that elimination of HSD3B7 prevents the critical epimerization of the hydroxyl group, confirming that the alpha stereochemistry of the 3-hydroxyl group is required for normal bile acid function .

What experimental models are available for studying HSD3B7 function?

Several experimental models have been developed for investigating HSD3B7 function:

In vitro models:

  • Recombinant expression systems using mammalian cell lines

  • Cell-free enzyme activity assays using purified recombinant protein

  • Cell blocks of HSD3B7-overexpressing breast cancer cell lines (e.g., E10-HSD3B1 derived from MCF-7)

In vivo models:

  • Complete HSD3B7 knockout mouse models generated via homologous recombination targeting all six exons of the gene

  • Conditional knockout systems using Cre-LoxP technology, where the neomycin resistance cassette is flanked by LoxP sites and contains a gene for Cre recombinase linked to a testis-specific promoter

Yeast complementation systems:

  • While not specifically documented for HSD3B7, similar approaches to those used for related enzymes like HSD17B7 (complementation of Erg27p-deficient yeast) could potentially be adapted

The HSD3B7 knockout mouse model is particularly valuable, as it exhibits a phenotype similar to human congenital bile acid synthesis defect type 1 and allows for detailed investigation of bile acid metabolism. The knockout strategy involved complete replacement of the gene (2.7 kb, six exons) with a cassette encoding neomycin resistance .

What are the methodologies for expressing and purifying recombinant HSD3B7?

While the search results don't provide specific protocols for HSD3B7 purification, the following methodological approach can be adapted from techniques used for related hydroxysteroid dehydrogenases:

Expression systems:

  • Bacterial expression: E. coli systems with appropriate tags (His, GST) for membrane proteins

  • Mammalian expression: HEK293 or CHO cells for proper post-translational modifications

  • Insect cell systems: Baculovirus-infected Sf9 cells for higher yields of functional membrane proteins

Purification strategies:

  • Membrane fraction isolation: Differential centrifugation followed by detergent solubilization

  • Affinity chromatography: Using tagged constructs (His-tag purification)

  • Size exclusion chromatography: For final polishing and separation of oligomeric states

Critical considerations:

  • As an ER membrane protein, detergent selection is crucial for maintaining activity

  • The endoplasmic reticulum localization necessitates careful subcellular fractionation

  • Cofactor requirements must be considered during purification and activity assays

  • Storage conditions should be optimized to prevent loss of activity

For verification of recombinant protein integrity, researchers typically employ Western blotting using specific antibodies, as demonstrated in immunohistochemistry protocols where anti-3β-HSD type 1 antibodies have been used at 1:200 dilution .

How can HSD3B7 enzymatic activity be assessed in vitro?

Based on the enzyme's function and drawing from approaches used with related enzymes, the following methodologies can be employed:

Spectrophotometric assays:

  • Monitor conversion of 7α-hydroxycholesterol to 7α-hydroxy-4-cholesten-3-one by measuring changes in absorbance at specific wavelengths

  • Track cofactor utilization (NAD+/NADH or NADP+/NADPH) through absorbance changes at 340 nm

Chromatographic analysis:

  • HPLC or LC-MS/MS quantification of substrate depletion and product formation

  • Use of radiolabeled substrates followed by thin-layer chromatography (TLC)

Key experimental parameters:

  • pH optimization (typically pH 7.0-8.0 for related hydroxysteroid dehydrogenases)

  • Temperature considerations (typically 37°C for human enzymes)

  • Cofactor concentration optimization

  • Detergent selection for solubilization of the membrane-bound enzyme

  • Substrate concentration range for kinetic parameter determination

For crystal structure studies, approaches similar to those used for the related enzyme 7α-HSDH could be adapted, including complexing the enzyme with its substrate and cofactor for X-ray diffraction analysis .

What are the species-specific differences in HSD3B7 activity?

While the search results don't explicitly detail species variations for HSD3B7, important lessons can be drawn from studies of related hydroxysteroid dehydrogenases:

Research with 17β-hydroxysteroid dehydrogenase type 1 (17β-HSD 1) has demonstrated profound differences in inhibitor susceptibility between human and animal orthologs . The most significant findings include:

  • Rodent enzymes (mouse and rat) were significantly less sensitive to inhibition compared to human orthologs

  • Marmoset enzymes showed the most similar inhibition patterns to human enzymes

  • Pig enzymes displayed intermediate susceptibility profiles

These findings have critical implications for drug development:

  • Promising inhibitors might be erroneously discarded during preclinical testing if assessed only in rodent models

  • Molecular docking experiments may not reliably predict species-specific inhibitor performance

Researchers studying HSD3B7 should be aware that similar species variations might exist and should:

  • Compare enzyme activity across multiple species

  • Validate inhibitor effects in human enzyme systems even if rodent results are discouraging

  • Consider using marmoset models for more translatable preclinical studies when possible

How does HSD3B7 expression change in disease states?

While HSD3B7's primary role is in bile acid synthesis, its expression has been investigated in contexts beyond liver disease:

Breast cancer:
A related enzyme, 3β-HSD type 1, has been studied in breast cancer with findings that may inform HSD3B7 research:

  • Expression was detected in 73.9% of 161 breast cancer cases

  • Positive correlation with estrogen receptor (ER) positivity

  • No significant correlation with HER-2 status

  • Potential prognostic significance in hormone-dependent breast cancers

These findings suggest that hydroxysteroid dehydrogenases may play roles beyond their primary metabolic functions and could potentially serve as biomarkers or therapeutic targets.

For researchers investigating HSD3B7 in disease contexts:

  • IHC protocols have been established using primary antibodies at 1:200 dilution

  • Positive controls include human placenta, adrenal gland (zona glomerulosa), and HSD3B1-overexpressing cell lines

  • Expression patterns should be analyzed in relation to established markers and clinical parameters

What CRISPR/Cas9 strategies are effective for studying HSD3B7?

While the search results don't specifically address CRISPR/Cas9 approaches for HSD3B7, the following methodological framework can be adapted from general CRISPR strategies and the knockout approaches described:

Guide RNA design considerations:

  • Target conserved exonic regions, particularly those encoding catalytic domains

  • Multiple guide RNAs can be designed to target different exons for complete gene knockout

  • For partial function studies, target specific functional domains

Delivery methods:

  • Plasmid-based delivery for stable cell lines

  • Ribonucleoprotein (RNP) complexes for transient editing with reduced off-target effects

  • Viral vectors for difficult-to-transfect cell types

Verification approaches:

  • Genomic PCR and sequencing to confirm mutations

  • Western blotting to verify protein depletion

  • Functional assays measuring bile acid production or conversion of specific substrates

  • Rescue experiments with wild-type or mutant constructs

For conditional systems, strategies similar to the Cre-LoxP system used in generating HSD3B7 knockout mice could be adapted to cell culture models with inducible CRISPR systems .

What are the current challenges and future directions in HSD3B7 research?

Based on the available literature, several research priorities and challenges emerge:

Structural biology challenges:

  • Obtaining crystal structures of human HSD3B7 with substrates and cofactors

  • Understanding the structural basis for substrate specificity

  • Characterizing the membrane-association domains and their impact on function

Therapeutic development opportunities:

  • Design of specific inhibitors or activators based on structural insights

  • Development of therapeutic approaches for congenital bile acid synthesis defect type 1

  • Exploration of potential roles in other disease contexts beyond primary bile acid disorders

Methodological challenges:

  • Developing improved assays for enzyme activity that accommodate the membrane-bound nature of the protein

  • Establishing relevant cellular and animal models that accurately reflect human pathophysiology

  • Addressing species differences in enzyme function when conducting preclinical studies

Emerging research questions:

  • Potential roles in metabolic diseases beyond classical bile acid disorders

  • Interactions with nuclear receptors and signaling pathways

  • Regulation of gene expression in response to metabolic and environmental factors

Researchers entering this field should consider interdisciplinary approaches combining structural biology, genetics, metabolomics, and clinical studies to fully elucidate the biology of this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.