Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2) is a crucial enzyme expressed in the adrenal cortex and gonads . It facilitates the conversion of Δ5-3β-hydroxysteroids into Δ4-3-keto isomers, which is essential for steroid hormone synthesis . Specifically, HSD3B2 converts pregnenolone to progesterone, 17α-hydroxypregnenolone (17OHPreg) to 17α-hydroxyprogesterone (17OHP), and dehydroepiandrosterone (DHEA) to androstenedione . This enzyme plays a vital role in producing mineralocorticoids, glucocorticoids, progestogens, androgens, and estrogens .

Enzymatic Activity and Function

HSD3B2 is a bifunctional enzyme that catalyzes the oxidative conversion of Delta 5-ene-3-beta-hydroxy steroid and the oxidative conversion of other steroids . Its activity is essential for the biosynthesis of steroid hormones, and its deficiency can result in various endocrine disorders .

Evaluation of HSD3B2 Activity

A novel system for evaluating the enzymatic activities of HSD3B2 in multiple pathways has been developed, comparing the potential for PR- and AR-mediated transactivation between substrates (P5 and DHEA) and products (P4 and A4) at various concentrations in CV-1 cells . Progesterone (P4) markedly increased PR-mediated transactivation from 10-9 M, while P5 did not increase transactivation at any concentration . Androstenedione (A4) increased AR-mediated transactivation from 10-8 M, whereas DHEA had almost no effect .

Table 1: Effects of Substrates and Products on Transactivation

Substrate/ProductPR-Mediated TransactivationAR-Mediated Transactivation
P5No increaseN/A
P4Increased from 10-9 MN/A
DHEAN/ANo effect
A4N/AIncreased from 10-8 M

Cell-Based Assay for HSD3B2 Activity

A cell-based assay was developed to detect the enzymatic activity of HSD3B2 . Western blot analyses using antibodies against HSD3B2 and GAPDH were performed using lysates from GFP- or HSD3B2-expressed HEK293 cells . The activation of human PR-mediated transcription was assessed using culture media from these cells . Similarly, the activation of human AR-mediated transcription was evaluated . Concentrations of P5/P4 and DHEA/A4 in the culture medium from HSD3B2-expressed HEK293 cells were measured at 2 and 3 hours after adding P5 (10 nM) and DHEA (10 nM), respectively .

Figure 1: HSD3B2 Activity Assay Results
(A) Western blot analyses of HSD3B2 expression.
(B) Activation of PR-mediated transcription.
(C) Activation of AR-mediated transcription.
(D) Concentrations of P5/P4 in culture medium.
(E) Concentrations of DHEA/A4 in culture medium.

Effects of HSD3B2 Mutations on Enzymatic Activities

The enzymatic activities of four HSD3B2 mutants (C72R, S124G, M225V, and V299I) were evaluated with and without salt-wasting (SW) . AR-mediated transactivation by culture media adding DHEA was markedly decreased in cells transfected with each mutant gene compared to wild-type protein . C72R, S124G, and M225V completely eliminated enzymatic activities, while V299I retained some residual activity (19.9% versus wild type) . PR-mediated transactivation also varied among mutants, with C72R, S124G, and M225V showing no induction, while V299I showed some activity (67.3% versus wild type) .

Table 2: Enzymatic Activities of HSD3B2 Mutants

MutantAR-Mediated Transactivation (% of Wild Type)PR-Mediated Transactivation (% of Wild Type)
C72R0%0%
S124G0%0%
M225V0%0%
V299I19.9%67.3%

Substrate-Dependent Enzymatic Activities

The conversion of DHEA into A4 was markedly reduced in all mutants, whereas the conversion of P5 into P4 was significantly reduced in C72R, S124G, and V225D . V299I maintained more than 50% activity compared to wild type . These results align with clinical phenotypes, where all patients exhibited ambiguous genitalia, but salt-wasting was observed in all except for the V299I patient .

Genetic Studies and Carrier Frequency

A study investigating the carrier frequency of the c.690G>A variant in the HSD3B2 gene detected eight heterozygous carriers in 339 samples . This variant has been associated with 3β-HSD deficiency in patients of Ossetian origin . Haplotype studies using SNP arrays revealed autozygosity regions encompassing the HSD3B2 locus, suggesting a common ancestor for the mutation .

Interactions with Liposomes

Data suggests that HSD3B2 interacts and unfolds in the presence of specific liposomes, such as unilamellar liposomes of DPPG/DPPC . This lipid-mediated interaction may play a role in the enzyme's function or regulation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
HSD3B2; HSDB3B; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II; 3-beta-HSD adrenal and gonadal type [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
HSD3B2
Target Protein Sequence
MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGD ILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIY TSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYT CALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRD PKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVS FLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVD RHKETLKSKTQ
Uniprot No.

Target Background

Function
3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ⁵-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a critical role in the biosynthesis of all hormonal steroid classes.
Gene References Into Functions
  1. Independent silencing of CRY1 and CRY2 genes in HAC15 cells mildly upregulated HSD3B2 without affecting HSD3B1 expression. These findings suggest that CRY1 and CRY2, as AngII-regulated genes exhibiting differential expression in APAs compared to the adjacent adrenal cortex, may be involved in adrenal cell function and aldosterone production regulation. PMID: 29874863
  2. A significant increase in HSD3B2 and ESR1 transcripts observed in eutrophic endometrial follicles from infertile women with endometriosis may be linked to the abnormal biological effects of E2 in the endometrium, potentially impacting embryo development. PMID: 29664547
  3. Sequencing revealed a homozygous p.W355R mutation at exon 4 of the HSD3B2 gene in two siblings. PMID: 27476613
  4. This study identified the first HSD3B2 gene mutation in the Italian population and analyzed its effect on 3β-HSD2 structure and function. PMID: 27082427
  5. Immunoreactivity for steroidogenic enzymes (P450scc, P450c17, and 3β-HSD) was observed in ovarian-type stroma from pancreatic mucinous cystic neoplasm cases (45.0%, 75.0%, and 65.0%, respectively). PMID: 27060902
  6. HSD3B2 deficiency and 21-hydroxylase deficiency share similar complications from under- and overtreatment, but HSD3B2 deficiency presents a distinct pattern of sex steroid dysmetabolism. PMID: 26079780
  7. Both the area and ratio of 3βHSD and CYB5A double-positive cells, potentially representing hybrid cells of the zona fasciculata and zona reticularis, correlate with adrenal development and may influence age-related serum androstenedione levels. PMID: 24832628
  8. CYP11A1, CYP17A1, HSD3B2, SRD5A2, and HSD17B6 mRNA levels were significantly lower in metastases. PMID: 24244276
  9. Two novel homozygous mutations in the HSD3B2 gene were identified as the cause of adrenocortical insufficiency in a studied family. PMID: 23026940
  10. A low ratio of cytochrome P450 family 17/3β-hydroxysteroid dehydrogenase type II with high steroid 11β-monooxygenase expression appears to explain the steroidogenic characteristics of aldosterone-producing adenomas. PMID: 23257735
  11. HSD3B SNPs and gene-gene interactions were investigated in relation to bladder cancer susceptibility. PMID: 23284679
  12. Interleukin-4 and prostaglandin E2 synergistically upregulate 3β-hydroxysteroid dehydrogenase type 2 in endometrioma stromal cells. PMID: 23450050
  13. In men, HSD3B2 SNPs were associated with a lower risk of paranoid ideation. PMID: 22356824
  14. Mitochondrial HSD3B2 activity requires a reversible pH-dependent conformational change at the intermembrane space. PMID: 22262841
  15. HSD3B2 interacts/unfolds in the presence of specific liposomes (unilamellar liposomes of DPPG/DPPC). This lipid-mediated unfolding supports a model where a cavity forms between the α-helix and β-sheet to activate the enzyme. PMID: 22106846
  16. Research on 3β-hydroxysteroid dehydrogenase type 2. PMID: 21930695
  17. Human adrenal cells expressing both 3β-hydroxysteroid dehydrogenase type 2 (HSD3B2) and cytochrome b5 (CYB5A) contribute to adrenal androstenedione production. PMID: 21185375
  18. SNPs within the HSD3B2 gene were not associated with essential hypertension. PMID: 20660004
  19. LRH-1, highly expressed in the corpus luteum, plays a key role in HSD3B2 regulation. PMID: 14671206
  20. Subtle molecular abnormalities in the HSD3B2 gene may be observed in some patients with apparent idiopathic hypospadias, although this is uncommon. PMID: 14764821
  21. Transcription enhancer factor-5 and the GATA-like protein coordinately determine the placental-specific expression of the human 3βHSD I enzyme. PMID: 15131259
  22. Research on the regulation of transcription by NGFI-B. PMID: 15208301
  23. HSD3B2 is upregulated by the nerve growth factor-induced clone B family of transcription factors. PMID: 15615861
  24. The HSD3B2 promoter (hHSD3B2), containing four consensus GATA elements, is an important target for GATA factors. PMID: 15928316
  25. Differences in fibroblast-derived glucocorticoid production (via 11β-HSD1) from different anatomical locations may contribute to tissue-specific persistent inflammation. PMID: 16846535
  26. The HSD3B2 (TG)n,(TA)n,(CA)n intron 3 length polymorphism is associated with prostate cancer risk and aggressiveness. PMID: 17823934
  27. Lower 3β-hydroxysteroid dehydrogenase type 2 but higher 17,20-lyase activity in NCI-H295R cells explains their androgenic steroid profile, resembling the zona reticularis of the human adrenal cortex. PMID: 18000308
  28. Three novel homozygous mutations in the HSD3B2 gene were characterized in patients with classic salt-losing 3β-HSD deficiency. The C-terminal part of the type II 3β-HSD protein is crucial for its function and processing. PMID: 18252794
  29. In cortices adjacent to adrenocortical adenomas, HSD3B2 mRNA was expressed in the zona glomerulosa and zona fasciculata, but only sporadically in the zona reticularis. PMID: 18505908
  30. The structure/function of HSD3B2 inhibition by trilostane is reported. PMID: 18524572
  31. SF1 and LRH1 can transcriptionally cooperate with AP-1 family members c-JUN and c-FOS (associated with endometrial carcinoma cell proliferation) to enhance activation of the STAR, HSD3B2, and CYP19A1 PII promoters. PMID: 19022561
  32. In human adrenal cells, FXR increases HSD3B2 transcription and expression. PMID: 19059462
  33. NGFI-B family members induced promoter activity of 3β-hydroxysteroid dehydrogenase type 2 (HSD3B2), 21-hydroxylase (CYP21A2), and aldosterone synthase (CYP11B2). PMID: 19158234
Database Links

HGNC: 5218

OMIM: 201810

KEGG: hsa:3284

STRING: 9606.ENSP00000358424

UniGene: Hs.654399

Involvement In Disease
Adrenal hyperplasia 2 (AH2)
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in adrenal gland, testis and ovary.

Q&A

What is the biochemical function of HSD3B2 in steroidogenesis?

HSD3B2 catalyzes the oxidation and isomerization of Δ5-3β-hydroxysteroid precursors to form Δ4-ketosteroids. This NAD+-dependent enzyme is membrane-bound and localizes to both the endoplasmic reticulum and mitochondria . The reaction is essential for the biosynthesis of all classes of active steroid hormones, including glucocorticoids, mineralocorticoids, and sex steroids . Unlike HSD3B1, which is expressed in the placenta and peripheral tissues, HSD3B2 is predominantly expressed in the adrenal gland, ovary, and testis, making it critical for steroidogenesis in these organs .

The enzyme catalyzes the conversion of key steroid hormone precursors:

  • Pregnenolone (P5) → Progesterone (P4)

  • Dehydroepiandrosterone (DHEA) → Androstenedione (A4)

These conversions represent crucial steps in the steroid hormone biosynthetic pathway and are essential for normal endocrine function.

What is the genomic structure and organization of the HSD3B2 gene?

The HSD3B2 gene has been extensively characterized through resequencing studies involving multiple ethnic groups. Research has identified numerous polymorphisms throughout the gene, including in coding regions, 5'-flanking regions (5'-FRs), and both 5'- and 3'-untranslated regions (UTRs) . Systematic identification of common polymorphisms has revealed 9 single nucleotide polymorphisms (SNPs) in HSD3B2, many of which were not previously present in public databases .

The gene contains several critical regions:

  • Coding sequences that determine the enzyme's structure and function

  • Regulatory regions (particularly 5'-flanking regions) that control gene expression

  • Membrane-binding domains that affect subcellular localization

Understanding this genomic structure is essential for interpreting the functional consequences of genetic variations.

How do specific mutations in HSD3B2 correlate with clinical phenotypes in congenital adrenal hyperplasia?

Mutations in the HSD3B2 gene can cause a rare form of congenital adrenal hyperplasia (CAH) with varying degrees of salt wasting and incomplete masculinization . To date, at least 31 different mutations have been identified, including 1 splicing, 1 in-frame deletion, 3 nonsense, 4 frameshift, and 22 missense mutations .

The genotype-phenotype correlation follows these patterns:

  • Severe salt-wasting forms of classical 3βHSD deficiency result from mutations that completely eliminate functional enzyme expression in adrenals and gonads

  • Non-salt-losing forms typically result from missense mutations that retain some residual enzyme activity

  • The degree of salt loss and genital ambiguity correlates with the extent of enzyme dysfunction

This correlation helps clinicians predict disease severity and guide treatment decisions based on specific genetic findings.

What role do HSD3B2 mutations play in the pathogenesis of hypospadias?

Recent studies have established a connection between HSD3B2 mutations and hypospadias, a congenital condition where the urethral opening is not at the tip of the penis. A novel missense mutation (Chr1:119964631T>A, c.507T>A, p. N169K) in the HSD3B2 gene has been identified in familial cases of hypospadias . This mutation segregated with the disease in affected family members in an autosomal recessive pattern .

Multiple in silico analyses using SIFT, PolyPhen-2, MutationAssessor, MutationTaster, FATHMM, and ConSurf consistently predicted this variant to be pathogenic/deleterious . The N169K substitution has three key characteristics that suggest pathogenicity:

  • Close proximity to catalytic sites (amino acids 154-158 and 269-273)

  • Location in an evolutionarily conserved region across species

  • Substitution of a neutral amino acid (asparagine) with a positively charged amino acid (lysine)

Other HSD3B2 mutations associated with hypospadias include S213T, S284R, A82P, and a 27-bp deletion (687del27) in exon IV . These findings suggest that abnormal fetal steroidogenesis due to HSD3B2 dysfunction can affect male genital tract development.

How can novel or rare HSD3B2 variants be functionally characterized?

Functional characterization of HSD3B2 variants is essential for determining their pathogenicity. Several approaches can be employed:

  • In vitro expression systems: Comparing wild-type and variant proteins expressed in cell culture systems (e.g., COS-1 or HEK293 cells)

  • Protein quantification: Using Western blot analysis to assess expression levels of variant proteins compared to wild-type, after correcting for transfection efficiency using β-galactosidase activity

  • Subcellular localization studies: Employing immunofluorescence microscopy to determine whether mutations alter the localization of the enzyme within cells

  • Enzymatic activity assays: Measuring conversion of substrates (pregnenolone, DHEA) to products (progesterone, androstenedione) using reporter assays

  • Transcriptional activity assays: Evaluating the impact of 5'-flanking region variants on gene expression using reporter constructs

These methods provide comprehensive functional data that can be correlated with clinical phenotypes.

What are the optimal methods for evaluating HSD3B2 enzymatic activity in research settings?

A novel method for evaluating HSD3B2 enzymatic activity utilizes progesterone receptor (PR)- and androgen receptor (AR)-mediated transactivation . This approach quantifies the conversion of substrates (pregnenolone and DHEA) to products (progesterone and androstenedione) through the following steps:

  • HEK293 cells are transduced to express human HSD3B2 (wild-type or mutant variants)

  • Cells are incubated with media containing pregnenolone (P5) or dehydroepiandrosterone (DHEA)

  • Culture media is collected at various time points

  • CV-1 cells transfected with PR/AR expression vector and progesterone/androgen-responsive reporter are exposed to the collected media

  • Luciferase activity is measured to quantify steroid conversion

The sensitivity of this assay is demonstrated by the differential response to substrate versus product:

SteroidConcentration for PR activationConcentration for AR activation
Pregnenolone (P5)No activation at any concentrationNot applicable
Progesterone (P4)Activation from 10^-9 MNot applicable
DHEANot applicableNo activation at any concentration
Androstenedione (A4)Not applicableActivation from 10^-8 M

This method allows for evaluation of enzymatic activity in multiple steroidogenic pathways simultaneously, providing a more comprehensive assessment of HSD3B2 function.

What genetic analysis approaches are most effective for identifying HSD3B2 mutations?

Multiple genetic analysis approaches have proven effective for identifying HSD3B2 mutations:

  • Gene resequencing: Systematically resequencing HSD3B2 using DNA from multiple ethnic groups (typically 60 samples from each of four different ethnic groups)

  • Whole Exome Sequencing (WES): Particularly useful for identifying novel variants in families with suspected genetic disorders

  • Sanger sequencing: Used to confirm variants identified through other methods and to verify segregation patterns within families

  • In silico analysis: Employing multiple prediction tools (SIFT, PolyPhen-2, MutationAssessor, MutationTaster, FATHMM, and ConSurf) to assess potential pathogenicity of identified variants

  • Haplotype analysis: Identifying common haplotypes across populations to understand the evolutionary and functional significance of genetic variations

These approaches, used individually or in combination, provide comprehensive genetic data that can inform functional studies and clinical correlations.

How can Western blot analysis be optimized for detecting HSD3B2 protein expression?

Optimal Western blot analysis for HSD3B2 protein involves several key steps:

  • Cell lysate preparation: Prepare supernatant lysates from cells transfected with wild-type or variant HSD3B2 expression constructs

  • Transfection efficiency normalization: Co-transfect cells with β-galactosidase and correct for variation in transfection efficiency based on β-galactosidase activity

  • Gel electrophoresis: Load corrected cell lysates on 12% SDS gels

  • Protein transfer: Transfer separated proteins to PVDF membranes

  • Antibody detection: Blot with monoclonal anti-His antibody (if using His-tagged constructs)

  • Quantification: Quantify results using appropriate imaging systems (e.g., radioanalytic imaging systems)

  • Data expression: Express data as a percentage of the intensity of the recombinant wild-type HSD3B2 protein band on the same gel

This protocol allows for accurate and reproducible quantification of HSD3B2 protein expression levels, facilitating comparison between wild-type and variant forms.

How can recombinant HSD3B2 be utilized in drug discovery and development?

Recombinant HSD3B2 serves as a valuable tool in drug discovery, particularly for conditions involving disrupted steroidogenesis. Applications include:

  • Screening potential enzyme inhibitors or activators: Using recombinant enzyme in high-throughput screening assays

  • Structure-function relationship studies: Using site-directed mutagenesis to understand critical residues for enzyme function

  • Pharmacological rescue studies: Testing compounds that might restore function to mutant enzymes

  • Developing targeted therapies: Creating drugs that could modulate HSD3B2 activity in specific steroidogenic disorders

The PR- and AR-mediated transactivation assay described in the research provides an excellent platform for such screening efforts .

What experimental considerations are important when studying ethnic-specific differences in HSD3B2 function?

When studying ethnic-specific differences in HSD3B2 function, several considerations are crucial:

  • Sample selection: Include adequate representation from different ethnic groups (e.g., Caucasian-American, African-American, Han Chinese-American, and Mexican-American populations)

  • Polymorphism identification: Resequence the entire gene, including coding regions, 5'-flanking regions, and untranslated regions

  • Haplotype analysis: Identify population-specific haplotype patterns that might influence gene function

  • Functional characterization: Evaluate the functional implications of ethnic-specific variants using reporter assays and enzyme activity measurements

  • Clinical correlation: Correlate genetic findings with clinical data from different populations to identify ethnic-specific disease patterns

These considerations help ensure that research findings are applicable across diverse populations and can inform personalized medical approaches.

What are the emerging technologies for studying HSD3B2 regulation and function?

Several emerging technologies show promise for advancing our understanding of HSD3B2:

  • CRISPR-Cas9 gene editing: Creating precise mutations or corrections in cellular and animal models

  • Single-cell transcriptomics: Studying cell-specific expression patterns of HSD3B2 in different tissues and developmental stages

  • Proteomics approaches: Identifying interaction partners and post-translational modifications of HSD3B2

  • Structural biology: Determining high-resolution structures of wild-type and mutant HSD3B2 to guide therapeutic development

  • Systems biology: Integrating genomic, transcriptomic, and proteomic data to understand HSD3B2's role in broader steroidogenic networks

These technologies will provide deeper insights into HSD3B2 function and potentially reveal new therapeutic targets.

How might HSD3B2 research contribute to personalized medicine approaches?

Research on HSD3B2 has significant implications for personalized medicine:

  • Genetic testing: Identifying specific HSD3B2 mutations can guide treatment decisions for patients with congenital adrenal hyperplasia or other steroidogenic disorders

  • Pharmacogenomics: Understanding how genetic variants affect response to steroid-based therapies

  • Prenatal diagnosis: Enabling early detection of HSD3B2 deficiency in at-risk pregnancies

  • Targeted therapies: Developing treatments that address specific mechanisms of enzyme dysfunction

  • Fertility treatments: Informing approaches for patients with infertility related to steroidogenic disorders

As our understanding of HSD3B2 continues to advance, these personalized approaches will become increasingly feasible and effective.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.