Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
Gene NameHACD2 (synonyms: PTPLB, Protein-tyrosine phosphatase-like member B)
Catalytic ActivityDehydration of 3-hydroxyacyl-CoA to trans-2-enoyl-CoA in VLCFA synthesis
Substrate SpecificityActs on saturated, monounsaturated, and polyunsaturated 3-OH acyl-CoAs
Post-Translational ModificationsNone reported; expressed with an N-terminal His-tag for purification

Production and Purification

This recombinant protein is typically synthesized in E. coli systems, yielding high-purity (>90%) preparations . The production process involves:

  1. Cloning: Full-length human HACD2 cDNA (amino acids 2–254) inserted into expression vectors.

  2. Expression: Induced in E. coli under optimized conditions.

  3. Purification: Affinity chromatography using nickel-NTA columns to capture the His-tagged protein .

Functional Role in Lipid Metabolism

HACD2 catalyzes the third step of the fatty acid elongation cycle, converting 3-hydroxyacyl-CoA to trans-2-enoyl-CoA . This reaction is critical for generating VLCFAs (>20 carbons), which:

  • Stabilize membrane curvature and microdomains .

  • Serve as precursors for sphingolipids and glycerophospholipids .

  • Influence metabolic disorders like obesity and diabetes when dysregulated .

Redundancy with HACD1:

  • HACD2 exhibits broader substrate specificity and higher activity than HACD1 .

  • Double knockout studies in mice show compounded reductions in VLCFA synthesis, confirming functional overlap .

Research Applications

Recombinant HACD2 is widely used in biochemical and disease-related studies:

Table: Experimental Uses

ApplicationProtocol DetailsCitation
Western BlotDetected at 29 kDa in MCF-7 and LO2 cell lysates using PACO37102 antibody .
ImmunohistochemistryValidated in paraffin-embedded human prostate cancer tissues .
Enzyme Activity AssaysMeasured via FA elongation assays using 3-OH palmitoyl-CoA .
Drug DiscoveryTargeted in screens for metabolic disorder therapies .

Comparative Insights from Model Organisms

  • Yeast Complementation: HACD2 restores VLCFA synthesis in Phs1-deficient yeast, confirming functional conservation .

  • Mouse Models: Hacd2 knockout studies reveal compensatory mechanisms with HACD1, though VLCFA levels remain suboptimal .

Challenges and Future Directions

  • Structural Data: No crystal structures are available; molecular dynamics studies are needed to elucidate substrate-binding mechanisms.

  • Therapeutic Targeting: Small-molecule inhibitors/modulators of HACD2 could address lipid metabolism disorders but remain unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HACD2; PTPLB; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 2; 3-hydroxyacyl-CoA dehydratase 2; HACD2; Protein-tyrosine phosphatase-like member B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-254
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
HACD2
Target Protein Sequence
AAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRR KILSHTEEHKKFE
Uniprot No.

Target Background

Function
This enzyme catalyzes the third step in the four-step cycle of very long-chain fatty acid (VLCFA) elongation (condensation, reduction, dehydration, and reduction). This endoplasmic reticulum-elongation process involves adding two carbons to the lipid chain during each cycle. Specifically, this enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA within each elongation cycle. Therefore, it contributes to the production of various VLCFAs involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Gene References Into Functions
  1. Mutations in HACD1 can lead to myopathies in humans. Knockout mice lacking Hacd1 exhibit myopathic phenotypes. Data from studies using knockout mice and cultured cells from knockout mice suggest that HACD1 and HACD2 have overlapping substrate specificities and thus appear to represent redundant activities in skeletal muscle. PMID: 28784662
  2. Research has identified a novel human member of the protein tyrosine phosphatase-like B (PTPLB) family, an integral protein of the endoplasmic reticulum membrane, as a BAP31-interacting protein. PMID: 15024066
Database Links

HGNC: 9640

OMIM: 615939

KEGG: hsa:201562

STRING: 9606.ENSP00000373153

UniGene: Hs.705480

Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in testis, spleen, prostate, colon and heart, followed by moderate expression in thymus, ovary, small intestine, peripheral blood leukocytes, liver, skeletal muscle and pancreas. Weakly detected in kidney, placenta, brain and lung.

Q&A

What is the biological function of PTPLB and why is it significant for researchers?

PTPLB (Protein Tyrosine Phosphatase Like Protein B), also known as HACD2 (3-hydroxyacyl-CoA dehydratase 2), catalyzes the third step (dehydration) in the conversion of long-chain fatty acids to very-long-chain fatty acids. This enzyme is localized to the endoplasmic reticulum membrane and plays a critical role in lipid metabolism . The significance of PTPLB extends beyond basic lipid biosynthesis, as studies have implicated its orthologs in neurodevelopmental processes. For instance, research suggests that the HACD family (including HACD1) has essential roles in myoblast proliferation and differentiation . Furthermore, PTPLB's involvement in very-long-chain fatty acid synthesis makes it relevant to multiple research areas including membrane biology, neuroscience, and metabolic disorders. Researchers should consider PTPLB not merely as an isolated enzyme but as part of a complex network of proteins involved in lipid homeostasis with far-reaching implications for cellular function.

How is PTPLB structurally characterized and what are its key protein domains?

PTPLB/HACD2 is a membrane protein with several conserved domains that can be identified using bioinformatics tools such as the Conserved Domain Database (CDD), Simple Modular Architecture Research Tool (SMART), and Protein Family Database (PFAM) . The protein has a predicted molecular mass of approximately 26.7 kDa, though the accurate molecular mass determined experimentally is around 25 kDa . The protein structure includes transmembrane domains that anchor it to the endoplasmic reticulum membrane, with the catalytic domain oriented toward the ER lumen .

Unlike classical protein tyrosine phosphatases, PTPLB lacks the canonical catalytic cysteine residue, with a proline residue substituted in its place (hence the alternative name "Proline Instead Of Catalytic Arginine Member b") . Researchers interested in structural studies should note that recombinant PTPLB is typically expressed with specific residues (Tyr41~Gln239) and may include an N-terminal His tag to facilitate purification . The protein has an isoelectric point of 8.9, which is important to consider when designing buffer systems for purification and functional studies .

What experimental models are available for studying PTPLB function?

Researchers have several experimental models available for studying PTPLB function. These include:

  • Recombinant Protein Expression Systems: PTPLB can be expressed in prokaryotic systems like Escherichia coli BL21 (DE3) RIL cells. This approach allows for production of sufficient quantities of protein for biochemical and structural studies . Expression protocols typically involve induction with IPTG at reduced temperatures (18°C) to maximize protein folding and solubility .

  • Knockout Models: Targeted gene disruption has been employed to generate PTPLB knockout models. For example, researchers have created Ptpro−/− mouse models to study the role of related phosphatases in cognitive function . Similar approaches can be applied to PTPLB/HACD2. These models allow for assessment of physiological functions through behavioral, biochemical, and histological analyses.

  • GFP-Tagged Models: GFP-tagged PTPLB (DEH-GFP) has been developed to study localization and dynamics in cellular contexts . These models enable real-time visualization of protein trafficking and interactions.

  • Orthologous Systems: Studies in model organisms like Plasmodium berghei have investigated PTPLA orthologs, providing comparative insights into conserved functions . The PbPTPLA has been characterized through bioinformatic approaches and transgenic parasite lines.

When selecting an experimental model, researchers should consider the specific research question, available resources, and required level of physiological relevance.

What expression systems are optimal for producing functional recombinant human PTPLB?

For producing functional recombinant human PTPLB/HACD2, prokaryotic expression systems, particularly Escherichia coli, have proven effective. Based on established protocols, the following expression system is recommended:

Bacterial Strain: E. coli BL21 (DE3) RIL cells are optimal as they contain extra copies of genes encoding tRNAs that are rare in E. coli but common in humans, helping to overcome codon bias issues .

Expression Vectors: Vectors containing an N-terminal His tag are advantageous for subsequent purification steps. The construct should include residues Tyr41~Gln239 of the human PTPLB protein .

Growth Conditions:

  • For standard protein production: Culture in LB medium with appropriate antibiotics at 37°C until OD600 reaches ~0.8.

  • For isotope-labeled protein (NMR studies): Culture in D2O-based M9 minimal media supplemented with 15NH4Cl (1 g/liter) for 15N labeling, or with specific precursors like [3-13C, 3-methyl-2H2, 3,4,4,4-2H4] α-ketoisovaleric acid (120 mg/liter) and [4-13C, 4-2H2, 3-2H2] α-ketobutyric acid (60 mg/liter) for 13C ILV labeling .

Induction Protocol: Add 1 mM IPTG when cultures reach OD600 of ~0.8, then incubate at 18°C for ~20 hours. The reduced temperature during induction is critical for proper protein folding and solubility .

Expected Yields: Wild-type PTPLB protein yields are approximately 55 mg/liter in LB and D2O-based M9 minimal media, while variant yields may range from 5 to 48 mg/liter .

This expression system balances yield, purity, and functional integrity of the recombinant protein, making it suitable for most research applications.

What are the critical considerations for maintaining stability and activity of recombinant PTPLB?

Maintaining stability and activity of recombinant PTPLB requires careful attention to several critical factors:

Reconstitution Protocol: Reconstitute lyophilized PTPLB in 10mM PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL. Importantly, vortexing should be avoided as it can lead to protein denaturation .

Storage Conditions:

  • Short-term storage (up to one month): Store at 2-8°C.

  • Long-term storage (up to 12 months): Aliquot and store at -80°C.

  • Avoid repeated freeze/thaw cycles, which significantly reduce protein stability and activity .

Thermal Stability: The stability profile of PTPLB has been characterized through accelerated thermal degradation testing. When incubated at 37°C for 48 hours, properly prepared PTPLB shows no obvious degradation or precipitation, with a loss rate of less than 5% within the expiration date under appropriate storage conditions .

Buffer Composition: The optimal buffer formulation for maintaining PTPLB stability is PBS (pH 7.4) containing 0.01% SKL and 5% Trehalose. The presence of trehalose is particularly important as this disaccharide acts as a stabilizing agent, preventing protein aggregation during freeze-thaw cycles .

Quality Control: Regular assessment of protein purity (should be >90%) and activity is recommended, especially after prolonged storage. SDS-PAGE and Western blotting can be used to confirm protein integrity before experimental use .

Researchers should document batch-to-batch variations and implement standardized handling protocols to ensure reproducible results across experiments.

How can researchers verify the functionality of recombinant PTPLB preparations?

Verification of recombinant PTPLB functionality requires a multi-faceted approach:

Enzymatic Activity Assay: The primary assessment should measure the dehydratase activity of PTPLB/HACD2. This can be accomplished by monitoring the conversion of 3-hydroxyacyl-CoA substrates to 2,3-trans-enoyl-CoA products. The reaction can be followed spectrophotometrically or through HPLC-based methods that detect either substrate depletion or product formation. When establishing activity assays, researchers should consider:

  • Substrate specificity (chain length preferences)

  • Optimal pH and temperature conditions

  • Cofactor requirements

  • Linear range of the assay

Structural Integrity Assessment: Nuclear Magnetic Resonance (NMR) spectroscopy, particularly 2D [1H, 15N] TROSY spectra, can provide detailed information about protein folding and structural integrity . Chemical Shift Perturbations (CSPs) observed upon substrate or inhibitor binding offer valuable insights into functional interactions. For proteins like PTPLB, where dynamic properties are crucial for function, 13C ILV ct-CPMG side-chain dynamics experiments can reveal conformational exchange processes essential for catalytic activity .

Binding Studies: Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) can be used to characterize binding affinities for substrates, inhibitors, or protein partners. These techniques provide thermodynamic parameters (Kd, ΔH, ΔS) that reflect functional competence.

Comparison to Reference Standards: Activity measurements should be benchmarked against reference standards when possible. For mutations or variants (e.g., L204A, P206G), comparing relative activities to wild-type PTPLB provides important functional context .

VariantRelative ActivityPrimary EffectStructural Impact
Wild-type PTPLB1.0 (reference)--
PTPLB L204AIncreasedChange in kcatNo significant structural changes (RMSD 0.15 Å)
PTPLB P206GUnchanged-Not determined
PTPLB GGGGGGIncreasedChange in KMNot determined

Table 1: Functional comparison of PTPLB variants based on data from reference

How does protein dynamics influence PTPLB enzyme activity and how can researchers investigate this relationship?

The relationship between protein dynamics and PTPLB enzyme activity represents a sophisticated area of research that extends beyond the traditional sequence-structure-function paradigm. Recent studies have demonstrated that intrinsic enzyme dynamics are equally important for regulating enzymatic function . For PTPLB and related phosphatases, conformational dynamics on the microsecond-millisecond timescale have been shown to critically influence catalytic properties.

Investigating Dynamics-Activity Relationships:

  • NMR Relaxation Experiments: 13C ILV constant-time Carr-Purcell-Meiboom-Gill (ct-CPMG) side-chain dynamics experiments are particularly valuable for studying PTPLB dynamics. These experiments directly report on microsecond/millisecond conformational exchange dynamics between different populations. The resulting data can be analyzed using a two-state model (Carver-Richards) to extract population distributions (pA and pB) and the rate of exchange between them (kex) .

  • Mutation Analysis: Strategic mutations can reveal how specific residues contribute to dynamic networks that influence catalysis. For example, studies on PTPLB have shown that mutations like L204A (located ~16 Å from the catalytic site) can increase enzymatic activity by altering kcat values without causing detectable structural changes in crystal structures (RMSD of 0.15 Å compared to wild-type) . This suggests that the effects are mediated through altered dynamics rather than static structural changes.

  • Computational Approaches: Molecular dynamics simulations can complement experimental approaches by providing atomistic details of protein motions. Analysis of evolutionarily conserved dynamic sectors (EDs) identified through coevolution analysis can highlight networks of residues that participate in collective motions important for function .

When designing experiments to investigate dynamics-activity relationships, researchers should consider that:

  • Dynamic effects may propagate through allosteric networks spanning considerable distances from the active site

  • Multiple timescales of motion (ps-ns and μs-ms) may contribute to enzyme function

  • Integration of structural, dynamic, and functional data is essential for developing a complete understanding

This research area demonstrates that understanding PTPLB function requires consideration of the protein as a dynamic entity rather than a static structure.

What is known about the role of PTPLB in neurological development and disease models?

The role of PTPLB and related phosphatases in neurological development and disease represents an emerging research area with significant implications. While PTPLB specifically has limited direct evidence in neurological contexts, related protein tyrosine phosphatases provide important insights that may guide PTPLB research:

Developmental Expression Patterns:
High expression of protein tyrosine phosphatase (PTP) orthologs has been observed in the brain of mice, zebrafish, and chickens during embryonic and early postnatal stages . For instance, PTPRO (a related phosphatase) peaks in mouse brain at embryonic day 16, coinciding with periods of intensive neuronal differentiation, axonogenesis, and synaptogenesis . This temporal expression pattern suggests critical roles during neurodevelopment that may extend to PTPLB.

Neurological Functions:
PTPs like PTPRO are important for the proper development and function of several brain structures, including the olfactory bulb, retinal ganglion cells, forebrain, and cerebellum . Some PTPs regulate neurite outgrowth and axonal guidance by inhibiting neurotrophin receptor signaling pathways like TRKB and RET . PTPLB may participate in similar regulatory networks given its structural relationship to other phosphatase-like proteins.

Association with Neurocognitive Function:
Evidence from genome-wide association studies (GWAS) suggests that certain PTPs are highly associated with neurocognitive function . In the context of aging and neurotoxicity, the level of some phosphatases has been found to decline significantly during aging, potentially contributing to age-related cognitive decline .

Experimental Models:
Knockout mouse models have been instrumental in studying PTPs in neurological contexts. For example, Ptpro−/− female mice have been used to investigate chemotherapy-related cognitive impairment (CRCI) . Similar approaches could be applied to study PTPLB's potential neurological functions.

Therapeutic Implications:
Some natural compounds like berberine (BBR) have shown promise in ameliorating cognitive impairment by regulating the expression of certain phosphatases . This suggests that targeting phosphatase pathways, potentially including PTPLB, may have therapeutic potential in neurological disorders.

Researchers investigating PTPLB in neurological contexts should consider:

  • Age-dependent expression patterns

  • Cell-type specificity within brain regions

  • Interactions with neurotrophin signaling pathways

  • Potential roles in synaptic plasticity and cognitive function

How can researchers effectively study PTPLB interactions with substrate analogs and inhibitors?

Investigating PTPLB interactions with substrate analogs and inhibitors requires a strategic approach combining structural, biochemical, and biophysical techniques:

Structural Characterization of Binding Interactions:

  • X-ray Crystallography: Co-crystallization of PTPLB with substrate analogs or inhibitors can provide atomic-level details of binding interactions. This approach has been successful with related phosphatases, revealing that inhibitor binding can lead to structural changes that are nearly identical to those observed with substrate analogs (RMSDs of ~0.14-0.15 Å) .

  • NMR Chemical Shift Perturbation (CSP) Analysis: 2D [1H, 15N] TROSY spectra can be collected for PTPLB in the absence and presence of ligands. Resulting CSPs identify residues involved in binding and conformational changes. This technique has been used successfully with phosphatases like PTP1B, showing that binding of compounds like TCS401 leads to specific CSPs that reflect functional interactions .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map regions of PTPLB that undergo changes in solvent accessibility upon ligand binding, providing complementary information to crystallography and NMR.

Functional Analysis of Inhibition:

ParameterMethodologySignificance
IC50Dose-response inhibition curvesPrimary screening metric
KiEnzyme kinetics varying substrate and inhibitorMechanism of inhibition
Residence TimeSPR or progress curve analysisDuration of inhibitor binding
SelectivityPanel screening against related enzymesSpecificity profile

Table 2: Parameters for characterizing PTPLB inhibitors

Molecular Basis of Selectivity:

When studying inhibitors, researchers should pay particular attention to structural elements that confer selectivity between PTPLB and related enzymes. For instance, studies with phosphatases have demonstrated that subtle structural differences can be exploited to develop highly selective inhibitors . Mutation studies (e.g., L204A, P206G) can help identify residues that influence inhibitor binding without directly participating in the catalytic mechanism .

Integration with Dynamics Analysis:

As with activity studies, investigation of inhibitor interactions should consider dynamic aspects. For example, 13C ILV ct-CPMG experiments comparing free and inhibitor-bound states can reveal how inhibitors alter the conformational exchange processes essential for function . This approach has shown that inhibitor binding can dramatically affect protein dynamics, even in regions distant from the binding site.

What are common challenges in working with recombinant PTPLB and how can they be addressed?

Researchers working with recombinant PTPLB/HACD2 often encounter several challenges that can impact experimental outcomes. Here are the most common issues and recommended solutions:

Low Expression Yields:

  • Challenge: PTPLB variants typically show lower expression levels (5-48 mg/liter) compared to wild-type (55 mg/liter) .

  • Solution: Optimize codon usage for the expression host, adjust induction conditions (lower IPTG concentration to 0.5 mM), and extend expression time at lower temperatures (16°C for 24 hours). Consider using specialized strains like E. coli BL21 (DE3) RIL that contain extra copies of rare tRNAs .

Protein Aggregation:

  • Challenge: As a membrane protein, PTPLB has hydrophobic regions that can lead to aggregation during expression and purification.

  • Solution: Include mild detergents (0.01% SKL) and stabilizing agents (5% Trehalose) in buffer formulations . When reconstituting lyophilized protein, strictly avoid vortexing and use gentle inversion mixing only .

Loss of Activity During Storage:

  • Challenge: Activity loss can occur even under recommended storage conditions.

  • Solution: Store as multiple small aliquots at -80°C to avoid repeated freeze-thaw cycles. For working stocks, limit storage at 2-8°C to one month maximum . Consider using accelerated stability testing (37°C incubation) to predict stability for each new batch .

Inconsistent Activity Measurements:

  • Challenge: Variation in activity measurements between experiments or batches.

  • Solution: Standardize assay conditions meticulously, including buffer composition, pH, temperature, and substrate concentration. Always include a well-characterized reference standard in each assay. Consider using internal normalization with a standard curve of known activity .

Interference in Spectroscopic Assays:

  • Challenge: Buffer components or sample impurities causing background interference.

  • Solution: Include appropriate blank controls with all components except enzyme. Consider using HPLC-based activity assays which may be less susceptible to optical interference than spectrophotometric methods.

Sample Heterogeneity in Structural Studies:

  • Challenge: Conformational heterogeneity complicating NMR or crystallography experiments.

  • Solution: Use size-exclusion chromatography immediately before structural studies. For NMR experiments, optimize temperature conditions to reduce exchange broadening. In extreme cases, identify and mutate residues involved in conformational exchange to stabilize a single state .

How can researchers optimize isotope labeling strategies for NMR studies of PTPLB?

Nuclear Magnetic Resonance (NMR) spectroscopy offers powerful insights into PTPLB structure, dynamics, and interactions, but requires careful optimization of isotope labeling strategies:

Labeling Strategies for Different NMR Applications:

  • Backbone Assignment and Chemical Shift Perturbation Studies:

    • Labeling Approach: Uniform 15N labeling using D2O-based M9 minimal media containing 15NH4Cl (1 g/liter) .

    • Experimental Application: 2D [1H, 15N] TROSY experiments for monitoring structural changes upon substrate or inhibitor binding.

    • Optimization Tip: Using D2O as the growth medium significantly improves spectral quality by reducing proton-proton dipolar relaxation.

  • Side-Chain Dynamics Studies:

    • Labeling Approach: Selective 13C-methyl labeling of isoleucine, leucine, and valine (ILV) residues using precursors like [3-13C, 3-methyl-2H2, 3,4,4,4-2H4] α-ketoisovaleric acid (120 mg/liter) and [4-13C, 4-2H2, 3-2H2] α-ketobutyric acid (60 mg/liter) in D2O-based media .

    • Experimental Application: 13C ILV constant-time Carr-Purcell-Meiboom-Gill (ct-CPMG) experiments to characterize μs-ms timescale dynamics.

    • Optimization Tip: Addition of labeled precursors should occur at OD600 ~0.6, before induction, to maximize incorporation.

Protocol Optimization:

ParameterRecommendationRationale
Growth Temperature37°C until induction, then 18°CBalances growth rate with proper protein folding
IPTG Concentration1 mM (in 100% D2O for deuterated samples)Ensures strong induction while maintaining isotopic purity
Expression Duration~20 hours post-inductionMaximizes yield while limiting proteolysis
Cell Density at InductionOD600 ~0.8Optimal balance between cell density and metabolic activity
Precursor Addition TimingOD600 ~0.6Ensures efficient incorporation before induction

Table 3: Optimal parameters for isotope-labeled PTPLB expression

Troubleshooting Labeling Efficiency:

  • Incomplete Labeling: If mass spectrometry indicates suboptimal incorporation, increase the concentration of labeled precursors by 10-20% and ensure they are added at the correct growth phase.

  • Scrambling of Labels: To minimize metabolic scrambling in 13C-methyl labeled samples, add 1 g/L of unlabeled glucose at the time of precursor addition to suppress amino acid biosynthesis from labeled metabolic intermediates.

  • Poor Spectral Quality: For deuterated samples showing poor spectral quality, extend growth time in D2O media before induction to allow for more complete adaptation of cells to deuterated conditions.

When planning NMR experiments, researchers should carefully consider the specific dynamic processes they wish to characterize in PTPLB, as this will dictate the optimal labeling strategy and experimental approach.

What controls are essential when studying PTPLB in different experimental contexts?

Establishing appropriate controls is critical for generating reliable and interpretable data when studying PTPLB. The essential controls vary depending on the experimental context:

For Enzymatic Activity Assays:

  • Negative Controls:

    • Heat-inactivated PTPLB (95°C for 10 minutes)

    • Reaction mixture without PTPLB

    • Catalytically inactive mutant (if available)

  • Positive Controls:

    • Commercial enzyme standards with defined activity units

    • Well-characterized wild-type PTPLB from previous batches

  • Specificity Controls:

    • Substrate specificity panel (varying acyl chain lengths)

    • Non-substrate analogs that should not be processed

For Protein-Protein Interaction Studies:

  • Negative Controls:

    • Non-specific proteins of similar size/charge characteristics

    • Binding assays with denatured PTPLB

  • Blocking Controls:

    • Competition assays with unlabeled interaction partners

    • Pre-incubation with known binding inhibitors

  • Specificity Controls:

    • Truncated constructs lacking suspected interaction domains

    • Point mutations at putative interaction interfaces

For Structural and Dynamic Studies:

  • Reference Samples:

    • Unliganded PTPLB under identical buffer conditions

    • PTPLB complexed with known ligands to benchmark response

  • Processing Controls:

    • Parallel processing of reference proteins with well-characterized NMR or crystallographic properties

    • Buffer-only samples processed identically to protein samples

  • Validation Controls:

    • Orthogonal techniques to confirm structural findings (e.g., circular dichroism to complement NMR)

    • Independent preparations to confirm reproducibility

For Cellular and In Vivo Studies:

Control TypeImplementationPurpose
Expression ControlWestern blot verificationConfirms expected protein expression level
Localization ControlSubcellular fractionationValidates predicted ER membrane localization
Functional ComplementationRescue experiments in knockout modelsConfirms phenotypes are specifically due to PTPLB
Phenotype SpecificityTesting related parameters (e.g., blood pressure, CBF, BBB integrity)Rules out indirect effects

Table 4: Essential controls for cellular and in vivo PTPLB studies

What are promising research frontiers for PTPLB studies based on recent findings?

Based on current literature and emerging trends, several promising research frontiers for PTPLB/HACD2 warrant investigation:

Neurodevelopmental and Neurocognitive Applications:
Recent findings with related phosphatases suggest potential roles in neurodevelopment and cognitive function . The evidence that some phosphatases are highly enriched in the hippocampus and their levels are tightly associated with neurocognitive function but decline significantly during aging opens interesting research avenues . Specific directions include:

  • Investigating PTPLB expression patterns in different brain regions across developmental stages and during aging

  • Exploring potential neuroprotective roles against chemotherapy-related cognitive impairment (CRCI) or other forms of neurodegeneration

  • Examining connections between very-long-chain fatty acid metabolism and synaptic function

Structural Dynamics and Allosteric Regulation:
The discovery that residues distant from the active site (e.g., L204A mutation located ~16 Å from the catalytic center) can significantly alter enzyme activity through dynamic effects rather than structural changes represents a paradigm shift in understanding PTPLB function . Future research should:

  • Map the complete network of dynamically coupled residues that influence catalysis

  • Develop allosteric modulators targeting these networks as potential therapeutic leads

  • Investigate how disease-associated mutations might disrupt these dynamic networks

Integration with Systems Biology Approaches:
As part of complex metabolic networks, PTPLB function should be studied in broader cellular contexts:

  • Multi-omics integration (proteomics, lipidomics, metabolomics) to understand how PTPLB activity influences global cellular metabolism

  • Network analysis using tools like STRING to identify PTPLB interacting proteins and regulatory pathways

  • Tissue-specific and condition-dependent regulation of PTPLB expression and activity

Therapeutic Applications:
Emerging evidence suggests potential therapeutic applications for modulators of PTPLB and related enzymes:

  • Exploration of natural compounds (like berberine) that may regulate PTPLB expression or activity

  • Development of selective small molecule modulators based on detailed understanding of dynamics and allosteric regulation

  • Investigation of PTPLB as a potential target in age-related cognitive decline or neurodegenerative conditions

Each of these research frontiers represents an opportunity to significantly advance our understanding of PTPLB biology while potentially yielding translational insights with clinical relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.