Recombinant Human 3-ketodihydrosphingosine reductase (KDSR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KDSR; FVT1; SDR35C1; 3-ketodihydrosphingosine reductase; KDS reductase; 3-dehydrosphinganine reductase; Follicular variant translocation protein 1; FVT-1; Short chain dehydrogenase/reductase family 35C member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-332
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
KDSR
Target Protein Sequence
KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQ VVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSIN YLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVK PYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNS SLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKS ENADKTA
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Gene References Into Functions
  1. KDSR (3-ketodihydrosphingosine reductase) mutations, affecting the ceramide synthesis pathway, cause a previously uncharacterized recessive Mendelian disorder within the progressive symmetric erythrokeratoderma spectrum. PMID: 28575652
  2. FVT-1, a mammalian 3-ketodihydrosphingosine reductase, possesses an active site facing the cytosolic side of the endoplasmic reticulum membrane. PMID: 15328338
  3. Studies indicate that FVT1 mutations do not significantly contribute to human motor neuron diseases. PMID: 18395445
  4. FVT1 shows significantly reduced expression in germinal center-type diffuse large B-cell lymphoma compared to non-germinal center-type DLBCL, follicular lymphoma, and normal tonsil controls. Increased FVT1 expression correlates with decreased survival. PMID: 19019774
  5. An Ala-175 to Thr mutation in the bovine ortholog, affecting a conserved residue in several species including humans, is associated with spinal muscular atrophy. PMID: 17420465
Database Links

HGNC: 4021

OMIM: 136440

KEGG: hsa:2531

STRING: 9606.ENSP00000385083

UniGene: Hs.74050

Involvement In Disease
Erythrokeratodermia variabilis et progressiva 4 (EKVP4)
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues examined. Highest expression in placenta. High expression in lung, kidney, stomach and small intestine, low expression in heart, spleen and skeletal muscle. Weakly expressed in normal hematopoietic tissues. Higher expression in so

Q&A

What is 3-ketodihydrosphingosine reductase (KDSR) and what is its primary function?

3-ketodihydrosphingosine reductase (KDSR) is an enzyme that catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine, playing a crucial role in the sphingolipid biosynthesis pathway . The enzyme's putative active site residues are positioned on the cytosolic side of the endoplasmic reticulum membrane, allowing for efficient interaction with its substrate . This reduction reaction represents a critical early step in sphingolipid metabolism, which has wide-ranging implications for cellular membrane structure, signaling pathways, and multiple physiological processes.

What alternative designations exist for the KDSR gene?

The KDSR gene is also known by several alternative designations in the scientific literature, including DHSR, FVT1, EKVP4, and SDR35C1 . These alternative names may appear in older publications or in specific research contexts, so researchers should be aware of these variations when conducting literature reviews or database searches.

What is the genomic context of the KDSR gene?

The KDSR gene is located on the long arm of chromosome 18 at position q21.33 (18q21.33) . The gene spans the genomic region from position 63,327,726 to 63,367,206 on the complement (negative) strand according to the NC_000018.10 reference assembly . The gene contains 10 exons, which undergo splicing to form the mature mRNA transcript that is subsequently translated into the KDSR protein .

What are the key considerations when designing experiments to study KDSR function?

When designing experiments to study KDSR function, researchers should carefully define their variables and hypotheses. The independent variables (IVs) might include different expression levels of KDSR, mutations in specific domains, or environmental conditions affecting KDSR activity . The dependent variables (DVs) would typically include measures of enzyme activity, sphingolipid levels, or cellular phenotypes .

It is crucial to control for extraneous variables that might confound results, such as expression levels of other enzymes in the sphingolipid pathway, cellular stress responses, or variations in experimental conditions . Randomization of experimental units and inclusion of appropriate control groups (e.g., wild-type KDSR, catalytically inactive mutants) are essential for establishing causality in KDSR functional studies .

How should researchers approach the comparison of wild-type versus mutant KDSR in experimental design?

A true experimental research design should be employed when comparing wild-type versus mutant KDSR. This approach requires:

  • Random assignment of experimental units (cells or organisms) to control and experimental groups

  • Systematic manipulation of the independent variable (KDSR genotype)

  • Control of extraneous variables that might influence the results

For example, when studying the effects of KDSR mutations associated with Erythrokeratodermia variabilis et progressiva 4, researchers should ensure that the expression levels of both wild-type and mutant forms are comparable . This might involve using isogenic cell lines with inducible expression systems to minimize variation due to genetic background or expression differences . Quantitative measurements of enzyme activity, substrate and product levels, and downstream cellular effects should be conducted under standardized conditions to enable valid comparisons.

What experimental approaches are most effective for analyzing KDSR enzymatic activity?

The most effective experimental approaches for analyzing KDSR enzymatic activity include:

  • In vitro enzyme assays: Using purified recombinant KDSR protein to measure conversion rates of 3-ketodihydrosphingosine to dihydrosphingosine under controlled conditions.

  • Cellular assays: Measuring KDSR activity in cellular contexts by supplementing cells with labeled precursors and tracking metabolic flux through the sphingolipid pathway.

  • Structural studies: Employing X-ray crystallography or cryo-EM to determine the three-dimensional structure of KDSR and how it interacts with substrates.

For accurate measurement of KDSR activity, researchers can use ELISA-based approaches that apply the competitive enzyme immunoassay technique with monoclonal anti-KDSR antibodies and KDSR-HRP conjugates . This approach allows for quantitative determination of KDSR concentration in experimental samples, with the intensity of the colorimetric reaction being inversely proportional to KDSR concentration .

How do contradictions in KDSR research findings impact our understanding of its function?

Analyzing contradictory findings in KDSR research requires a systematic approach to identify the source of discrepancies. These contradictions might arise from differences in experimental systems, methodologies, or interpretations of data .

When confronted with contradictory findings, researchers should:

  • Examine methodological differences between studies (e.g., in vitro vs. in vivo, different cell types, varying assay conditions)

  • Consider species-specific differences in KDSR function or regulation

  • Analyze whether contradictions reflect genuine biological complexity rather than experimental artifacts

  • Apply statistical meta-analysis to integrate findings across studies where appropriate

For example, contradictory findings regarding the phenotypic effects of KDSR mutations might be reconciled by considering genetic background, environmental factors, or compensatory mechanisms that differ between experimental systems . Systematic documentation of experimental conditions and comprehensive reporting of both positive and negative results are essential for resolving contradictions in the literature.

What are the implications of KDSR mutations in human disease pathogenesis?

KDSR mutations have been implicated in several human diseases, most notably Erythrokeratodermia variabilis et progressiva 4 . Additionally, chromosomal rearrangements involving KDSR are associated with follicular lymphoma, also known as type II chronic lymphatic leukemia .

The mechanistic link between KDSR dysfunction and disease manifestation likely involves:

  • Altered sphingolipid homeostasis leading to membrane dysfunction

  • Disruption of sphingolipid-dependent signaling pathways

  • Accumulation of potentially toxic intermediates or precursors

  • Defects in cell-type specific functions dependent on proper sphingolipid composition

Interestingly, mutation of a conserved residue in the bovine ortholog of KDSR causes spinal muscular atrophy, suggesting a critical role for this enzyme in neuronal function across species . Further research into tissue-specific requirements for KDSR activity and the consequences of its dysfunction will enhance our understanding of its role in human disease.

How does post-translational regulation impact KDSR activity in different cellular contexts?

Post-translational regulation of KDSR represents an advanced research area with significant implications for understanding context-dependent enzyme function. While the literature provides limited direct information on KDSR post-translational modifications, several regulatory mechanisms can be hypothesized based on knowledge of related enzymes:

  • Phosphorylation of specific residues may modulate KDSR activity in response to signaling pathways

  • Protein-protein interactions could regulate subcellular localization or substrate accessibility

  • Membrane composition might affect the enzymatic efficiency of KDSR given its endoplasmic reticulum localization

Research approaches to investigate these mechanisms should employ phosphoproteomic analysis, interaction screening, and membrane reconstitution experiments. Quantitative analysis of how these modifications affect enzyme kinetics would provide valuable insights into the contextual regulation of sphingolipid biosynthesis.

What are the advantages and limitations of different KDSR detection methods?

Different methods for detecting and measuring KDSR have distinct advantages and limitations that researchers should consider when designing experiments:

Detection MethodAdvantagesLimitationsBest Applications
ELISAHigh specificity, quantitative results, able to detect native KDSRMay not detect all isoforms equally, requires specific antibodiesQuantification in biological samples
Western BlotSize verification, semi-quantitative, detects denatured proteinLower throughput, less quantitative than ELISAVerification of expression, size variants
qPCRHigh sensitivity for transcript detection, isoform-specificMeasures mRNA not protein, post-transcriptional regulation not capturedGene expression studies
Activity AssaysDirectly measures enzymatic functionComplex setup, potentially affected by other enzymesFunctional studies
Mass SpectrometryHighly specific, can detect post-translational modificationsRequires specialized equipment, complex sample preparationDetailed molecular characterization

For instance, the ELISA kit described in the search results applies a competitive enzyme immunoassay technique using monoclonal anti-KDSR antibody and KDSR-HRP conjugate . This method is particularly useful for detecting native KDSR in body fluids and tissue homogenates, with the intensity of color being inversely proportional to KDSR concentration .

How should researchers approach KDSR knockout or knockdown studies?

When designing KDSR knockout or knockdown studies, researchers should consider several methodological aspects:

  • Selection of appropriate model system: Given KDSR's fundamental role in sphingolipid biosynthesis, complete knockout might be lethal in some systems. Conditional knockout models or partial knockdown approaches may be more informative.

  • Verification of knockout/knockdown efficiency: Both mRNA and protein levels should be measured to confirm the degree of KDSR depletion. Additionally, sphingolipid profiling should be performed to assess functional consequences.

  • Control for compensatory mechanisms: Long-term depletion of KDSR might trigger compensatory pathways that mask the primary effects of KDSR deficiency. Acute depletion systems (e.g., inducible knockout) can help distinguish primary from adaptive responses.

  • Rescue experiments: Reintroduction of wild-type KDSR or mutant variants can confirm specificity and provide structure-function insights.

A robust experimental design would include time-course analysis after KDSR depletion, comprehensive sphingolipid profiling, and assessment of cellular phenotypes across multiple model systems to ensure reproducibility and biological relevance.

What experimental design considerations are critical when studying KDSR interactions with other enzymes in the sphingolipid pathway?

When investigating KDSR interactions with other enzymes in the sphingolipid biosynthetic pathway, the experimental design must account for the complexity of metabolic networks:

  • Variable manipulation: Independent variables should include expression levels or activities of multiple enzymes, while dependent variables might encompass metabolite concentrations, flux rates, or biological outcomes .

  • Factorial experimental designs: These allow systematic exploration of how multiple enzymes interact to influence pathway output. For example, a 2×2 factorial design might examine how KDSR and serine palmitoyltransferase (an upstream enzyme) jointly affect sphingolipid production .

  • Metabolic flux analysis: Isotope labeling and time-course sampling can reveal how perturbations in KDSR activity ripple through the pathway.

  • Protein-protein interaction studies: Co-immunoprecipitation, proximity labeling, or FRET analyses can identify physical interactions between KDSR and other pathway components.

Proper randomization and statistical design are crucial for interpreting complex datasets resulting from multi-enzyme studies . Researchers should consider employing computational modeling to integrate experimental data and generate testable predictions about pathway behavior under various conditions.

What are the main technical challenges in producing functional recombinant human KDSR for structural studies?

The production of functional recombinant human KDSR presents several technical challenges:

  • Membrane protein expression: As an endoplasmic reticulum membrane-associated protein, KDSR can be difficult to express in heterologous systems while maintaining proper folding and activity.

  • Purification complexity: Extraction from membranes requires detergents that must maintain protein structure while allowing purification.

  • Structural stability: Preserving enzymatic activity during purification and crystallization attempts is particularly challenging for membrane-associated enzymes.

  • Reconstitution requirements: For functional studies, the enzyme often needs to be reconstituted in an appropriate lipid environment that mimics its native context.

Advanced expression strategies might include:

  • Using insect cell or mammalian expression systems rather than bacterial systems

  • Engineering fusion proteins to enhance solubility or facilitate purification

  • Employing nanodiscs or other membrane mimetics to maintain native-like environments

  • Exploring cryo-EM as an alternative to crystallography for structural determination

How might contradictions in KDSR research findings be resolved through improved experimental design?

Resolving contradictions in KDSR research requires thoughtful experimental design:

  • Standardization of methods: Developing consensus protocols for KDSR activity assays, expression systems, and analytical techniques would facilitate direct comparison between studies .

  • Comprehensive reporting: Detailed documentation of experimental conditions, including buffer compositions, temperature, pH, and substrate concentrations, would help identify sources of variability .

  • Multi-laboratory validation: Collaborative studies involving multiple research groups can assess reproducibility and identify lab-specific factors that might contribute to contradictory results.

  • Integration of multiple approaches: Combining in vitro biochemistry, cellular studies, and in vivo models provides complementary perspectives that can help reconcile apparently contradictory findings .

  • Meta-analysis frameworks: Developing systematic approaches to integrate and weight evidence from multiple studies could help resolve contradictions by identifying patterns across diverse experimental contexts .

By addressing these methodological considerations, researchers can build a more coherent understanding of KDSR function and its biological significance.

What novel research directions might emerge from integrating KDSR studies with advances in sphingolipid biology?

Emerging research directions at the intersection of KDSR studies and sphingolipid biology include:

  • Single-cell sphingolipidomics: Applying single-cell analytical techniques to understand cell-to-cell variability in KDSR function and sphingolipid metabolism.

  • Organelle-specific KDSR regulation: Investigating how KDSR activity might be differentially regulated in distinct subdomains of the endoplasmic reticulum.

  • Interaction with lipid rafts: Exploring how KDSR-dependent sphingolipid production influences membrane microdomain formation and function.

  • Therapeutic targeting: Developing small molecule modulators of KDSR activity as potential therapeutic agents for disorders of sphingolipid metabolism.

  • Systems biology integration: Creating comprehensive computational models that incorporate KDSR function within the broader context of lipid metabolism and signaling networks.

These directions represent frontier areas where significant discoveries about KDSR biology are likely to emerge in the coming years, potentially transforming our understanding of sphingolipid metabolism and its role in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.